FuNGI

Q756J7

Protein Details

Accession

Q756J7

Localization Confidence

Medium

Confidence Score

14.5

NoLS Segment(s)

Position	Sequence	Protein Nature
436-477	YEDKDAKKLRKSEAKENKRERRKTKVKKHIKKKLLKKTKSSK	Basic

NLS Segment(s)

Position	Sequence
435-477	KYEDKDAKKLRKSEAKENKRERRKTKVKKHIKKKLLKKTKSSK

Subcellular Location(s)

nucl 25.5, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR011009 Kinase-like_dom_sf IPR000687 RIO_kinase IPR018935 RIO_kinase_CS IPR017407 Ser/Thr_kinase_Rio1
Gene Ontology	GO:0005829 C:cytosol GO:0030874 C:nucleolar chromatin GO:0030688 C:preribosome, small subunit precursor GO:0005524 F:ATP binding GO:0016787 F:hydrolase activity GO:0046872 F:metal ion binding GO:0004674 F:protein serine/threonine kinase activity GO:0030490 P:maturation of SSU-rRNA GO:0000462 P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:0016479 P:negative regulation of transcription by RNA polymerase I GO:0016310 P:phosphorylation GO:2000234 P:positive regulation of rRNA processing GO:0007096 P:regulation of exit from mitosis
KEGG	ago:AGOS_AER257W -
Pfam	View protein in Pfam PF01163 RIO1
PROSITE	View protein in PROSITE PS01245 RIO1
CDD	cd05147 RIO1_euk

Amino Acid Sequences

MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYDLSDSDDAEDEDEDADEGQDEDGSESGTDSDSSSDDESGDDKDDYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERRKTKVKKHIKKKLLKKTKSSK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.52
2	0.58
3	0.64
4	0.7
5	0.64
6	0.58
7	0.51
8	0.49
9	0.44
10	0.36
11	0.31
12	0.25
13	0.32
14	0.37
15	0.42
16	0.38
17	0.37
18	0.38
19	0.37
20	0.36
21	0.3
22	0.24
23	0.23
24	0.25
25	0.26
26	0.28
27	0.31
28	0.36
29	0.43
30	0.51
31	0.56
32	0.63
33	0.71
34	0.72
35	0.78
36	0.75
37	0.69
38	0.65
39	0.59
40	0.52
41	0.47
42	0.43
43	0.34
44	0.32
45	0.29
46	0.25
47	0.29
48	0.25
49	0.23
50	0.22
51	0.22
52	0.29
53	0.35
54	0.38
55	0.33
56	0.37
57	0.35
58	0.34
59	0.33
60	0.25
61	0.21
62	0.19
63	0.17
64	0.14
65	0.14
66	0.13
67	0.13
68	0.13
69	0.14
70	0.13
71	0.14
72	0.16
73	0.16
74	0.2
75	0.24
76	0.23
77	0.19
78	0.19
79	0.18
80	0.15
81	0.15
82	0.12
83	0.08
84	0.08
85	0.09
86	0.08
87	0.09
88	0.09
89	0.09
90	0.1
91	0.12
92	0.12
93	0.16
94	0.19
95	0.19
96	0.22
97	0.22
98	0.24
99	0.24
100	0.25
101	0.25
102	0.25
103	0.29
104	0.3
105	0.34
106	0.39
107	0.38
108	0.38
109	0.36
110	0.34
111	0.34
112	0.38
113	0.34
114	0.35
115	0.35
116	0.35
117	0.36
118	0.35
119	0.36
120	0.33
121	0.42
122	0.42
123	0.53
124	0.61
125	0.66
126	0.73
127	0.7
128	0.76
129	0.69
130	0.66
131	0.63
132	0.64
133	0.58
134	0.59
135	0.6
136	0.51
137	0.56
138	0.59
139	0.53
140	0.49
141	0.46
142	0.42
143	0.45
144	0.46
145	0.41
146	0.34
147	0.36
148	0.34
149	0.37
150	0.34
151	0.27
152	0.26
153	0.24
154	0.21
155	0.19
156	0.16
157	0.17
158	0.17
159	0.18
160	0.19
161	0.19
162	0.18
163	0.17
164	0.15
165	0.1
166	0.12
167	0.1
168	0.1
169	0.1
170	0.09
171	0.09
172	0.09
173	0.1
174	0.09
175	0.14
176	0.17
177	0.16
178	0.18
179	0.2
180	0.21
181	0.25
182	0.27
183	0.33
184	0.35
185	0.38
186	0.39
187	0.38
188	0.39
189	0.4
190	0.4
191	0.33
192	0.32
193	0.28
194	0.27
195	0.26
196	0.24
197	0.18
198	0.14
199	0.1
200	0.08
201	0.08
202	0.07
203	0.07
204	0.07
205	0.08
206	0.11
207	0.14
208	0.12
209	0.13
210	0.13
211	0.13
212	0.13
213	0.12
214	0.09
215	0.06
216	0.08
217	0.07
218	0.07
219	0.07
220	0.07
221	0.08
222	0.08
223	0.08
224	0.07
225	0.07
226	0.08
227	0.1
228	0.1
229	0.09
230	0.08
231	0.09
232	0.09
233	0.1
234	0.1
235	0.09
236	0.09
237	0.09
238	0.1
239	0.1
240	0.09
241	0.09
242	0.08
243	0.09
244	0.09
245	0.1
246	0.09
247	0.08
248	0.11
249	0.1
250	0.11
251	0.11
252	0.11
253	0.14
254	0.14
255	0.16
256	0.14
257	0.15
258	0.14
259	0.14
260	0.14
261	0.09
262	0.09
263	0.07
264	0.08
265	0.08
266	0.08
267	0.07
268	0.07
269	0.07
270	0.07
271	0.09
272	0.08
273	0.07
274	0.08
275	0.08
276	0.1
277	0.09
278	0.1
279	0.09
280	0.11
281	0.12
282	0.11
283	0.11
284	0.12
285	0.15
286	0.15
287	0.16
288	0.19
289	0.26
290	0.27
291	0.27
292	0.25
293	0.22
294	0.21
295	0.21
296	0.16
297	0.09
298	0.12
299	0.17
300	0.2
301	0.24
302	0.26
303	0.27
304	0.27
305	0.28
306	0.28
307	0.28
308	0.27
309	0.24
310	0.24
311	0.24
312	0.26
313	0.24
314	0.21
315	0.18
316	0.15
317	0.14
318	0.13
319	0.14
320	0.16
321	0.19
322	0.2
323	0.18
324	0.2
325	0.2
326	0.19
327	0.17
328	0.14
329	0.12
330	0.13
331	0.14
332	0.13
333	0.13
334	0.13
335	0.17
336	0.17
337	0.16
338	0.2
339	0.2
340	0.21
341	0.22
342	0.23
343	0.19
344	0.19
345	0.19
346	0.13
347	0.17
348	0.17
349	0.17
350	0.17
351	0.17
352	0.2
353	0.21
354	0.21
355	0.17
356	0.15
357	0.18
358	0.18
359	0.18
360	0.15
361	0.18
362	0.18
363	0.19
364	0.18
365	0.15
366	0.15
367	0.14
368	0.16
369	0.13
370	0.12
371	0.11
372	0.12
373	0.11
374	0.11
375	0.11
376	0.09
377	0.08
378	0.08
379	0.07
380	0.06
381	0.06
382	0.05
383	0.06
384	0.05
385	0.05
386	0.06
387	0.06
388	0.06
389	0.07
390	0.06
391	0.06
392	0.07
393	0.07
394	0.07
395	0.07
396	0.08
397	0.08
398	0.1
399	0.11
400	0.11
401	0.11
402	0.11
403	0.12
404	0.12
405	0.14
406	0.12
407	0.12
408	0.13
409	0.16
410	0.17
411	0.24
412	0.25
413	0.23
414	0.24
415	0.24
416	0.32
417	0.36
418	0.41
419	0.4
420	0.46
421	0.53
422	0.55
423	0.64
424	0.63
425	0.61
426	0.66
427	0.71
428	0.72
429	0.72
430	0.76
431	0.76
432	0.77
433	0.78
434	0.79
435	0.8
436	0.8
437	0.83
438	0.88
439	0.89
440	0.9
441	0.93
442	0.9
443	0.9
444	0.9
445	0.91
446	0.91
447	0.92
448	0.92
449	0.93
450	0.96
451	0.96
452	0.95
453	0.95
454	0.94
455	0.94
456	0.94
457	0.93

Q756J7

3D AlphaFold-predicted Structure Viewer