Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5FSU1

Protein Details
Accession C5FSU1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-69LYAERLKRASRNREKARENRARIHydrophilic
NLS Segment(s)
PositionSequence
53-66KRASRNREKARENR
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSHLHTKDNINCEEIMTMLDECHARGFMHKVFGNCNDVKREVNRCLYAERLKRASRNREKARENRARIEKLWNEDAAQGQMSTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.22
3 0.17
4 0.12
5 0.1
6 0.08
7 0.09
8 0.08
9 0.08
10 0.09
11 0.09
12 0.08
13 0.1
14 0.14
15 0.14
16 0.19
17 0.21
18 0.21
19 0.23
20 0.26
21 0.29
22 0.27
23 0.27
24 0.24
25 0.24
26 0.25
27 0.26
28 0.29
29 0.28
30 0.3
31 0.3
32 0.28
33 0.28
34 0.3
35 0.33
36 0.33
37 0.34
38 0.36
39 0.37
40 0.43
41 0.5
42 0.56
43 0.6
44 0.66
45 0.71
46 0.74
47 0.8
48 0.82
49 0.85
50 0.84
51 0.79
52 0.78
53 0.76
54 0.72
55 0.65
56 0.66
57 0.61
58 0.57
59 0.55
60 0.47
61 0.39
62 0.37
63 0.37
64 0.29
65 0.24
66 0.18