Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5FHU8

Protein Details
Accession C5FHU8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-67QKSFRTKQKLAKAQKQNRPIPHydrophilic
73-94RTGNTIRYNAKRRHWRKTRLGIHydrophilic
NLS Segment(s)
PositionSequence
82-90AKRRHWRKT
Subcellular Location(s) mito 14.5, mito_nucl 13.666, nucl 11.5, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MTGSSKRAHFTQNFLLFSPSDHKTNFSRNAQDIQGRDSSESVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.35
4 0.34
5 0.33
6 0.25
7 0.21
8 0.2
9 0.23
10 0.24
11 0.32
12 0.37
13 0.37
14 0.4
15 0.4
16 0.42
17 0.42
18 0.42
19 0.35
20 0.31
21 0.29
22 0.24
23 0.22
24 0.19
25 0.18
26 0.15
27 0.15
28 0.13
29 0.14
30 0.18
31 0.19
32 0.23
33 0.25
34 0.29
35 0.34
36 0.4
37 0.47
38 0.51
39 0.55
40 0.58
41 0.65
42 0.7
43 0.73
44 0.75
45 0.76
46 0.78
47 0.8
48 0.82
49 0.79
50 0.77
51 0.74
52 0.72
53 0.67
54 0.66
55 0.67
56 0.61
57 0.6
58 0.56
59 0.54
60 0.53
61 0.54
62 0.54
63 0.49
64 0.51
65 0.52
66 0.58
67 0.64
68 0.64
69 0.66
70 0.69
71 0.73
72 0.78
73 0.82
74 0.83