Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545UPL1

Protein Details
Accession A0A545UPL1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRMRLRAVDSVHydrophilic
77-105KYTIFDRKAKKFRKGIHKVPKWTRVSQRIHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKKFRKGIHKVPK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSKFQKRRHRMRLRAVDSVVATLDAALAKQGQTLAALERWKADMPQEEEMLPKDKYTIFDRKAKKFRKGIHKVPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.88
20 0.89
21 0.9
22 0.84
23 0.8
24 0.7
25 0.61
26 0.5
27 0.41
28 0.3
29 0.19
30 0.13
31 0.07
32 0.07
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.07
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.1
51 0.11
52 0.15
53 0.18
54 0.2
55 0.21
56 0.2
57 0.2
58 0.22
59 0.23
60 0.17
61 0.14
62 0.13
63 0.13
64 0.16
65 0.21
66 0.29
67 0.3
68 0.39
69 0.46
70 0.55
71 0.64
72 0.69
73 0.72
74 0.71
75 0.76
76 0.78
77 0.81
78 0.81
79 0.82
80 0.84
81 0.85
82 0.86
83 0.87
84 0.82
85 0.81
86 0.8
87 0.79
88 0.79
89 0.77
90 0.79