Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FZH0

Protein Details
Accession C5FZH0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
293-314LGMVIKKKPNEAVRRVRQNKSWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002994  Surf1/Shy1  
IPR045214  Surf1/Surf4  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF02104  SURF1  
PROSITE View protein in PROSITE  
PS50895  SURF1  
CDD cd06662  SURF1  
Amino Acid Sequences MAATFSLRRFALSPVSRRPGLLSTGRIQTPCLRCVKSQVRRAHTPAEDPNWTSIVDNPAKLVRTGGKHGYGLIILAIIPITAFALGTWQVQRLEWKSNLIAKYEDRLIKPPLPLPPIVDPESVGDFEYRRVYAKGRLRHDKEMLIGPRMQEGKDGYLVVTPLERGEGESTILVNRGWIAKTLEKQSDRPEGLPQEEVVIEGLLRSPWKKNMFTPDNKPEEGKFYFPDVRQMAELTGSQPVWIEETMVQDLLSMYNREDKGIPIGRTAEVHLRNNHAQYIFTWYGLSLATAIMLGMVIKKKPNEAVRRVRQNKSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.5
4 0.49
5 0.5
6 0.43
7 0.42
8 0.4
9 0.36
10 0.34
11 0.4
12 0.42
13 0.38
14 0.38
15 0.41
16 0.4
17 0.41
18 0.44
19 0.41
20 0.39
21 0.49
22 0.57
23 0.58
24 0.62
25 0.65
26 0.66
27 0.7
28 0.74
29 0.72
30 0.64
31 0.61
32 0.59
33 0.56
34 0.52
35 0.46
36 0.43
37 0.36
38 0.33
39 0.27
40 0.23
41 0.26
42 0.24
43 0.23
44 0.22
45 0.24
46 0.25
47 0.24
48 0.24
49 0.21
50 0.22
51 0.27
52 0.3
53 0.29
54 0.29
55 0.29
56 0.27
57 0.22
58 0.18
59 0.13
60 0.08
61 0.05
62 0.05
63 0.05
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.07
74 0.08
75 0.1
76 0.11
77 0.11
78 0.17
79 0.18
80 0.23
81 0.23
82 0.25
83 0.25
84 0.31
85 0.31
86 0.28
87 0.28
88 0.23
89 0.25
90 0.28
91 0.29
92 0.25
93 0.28
94 0.3
95 0.31
96 0.32
97 0.32
98 0.31
99 0.3
100 0.29
101 0.29
102 0.28
103 0.29
104 0.3
105 0.26
106 0.22
107 0.2
108 0.21
109 0.18
110 0.15
111 0.11
112 0.09
113 0.1
114 0.12
115 0.1
116 0.11
117 0.11
118 0.13
119 0.2
120 0.27
121 0.33
122 0.39
123 0.49
124 0.52
125 0.56
126 0.57
127 0.5
128 0.45
129 0.44
130 0.38
131 0.3
132 0.27
133 0.21
134 0.23
135 0.22
136 0.2
137 0.15
138 0.14
139 0.13
140 0.13
141 0.13
142 0.09
143 0.09
144 0.09
145 0.07
146 0.07
147 0.05
148 0.04
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.06
158 0.07
159 0.06
160 0.05
161 0.05
162 0.06
163 0.06
164 0.08
165 0.11
166 0.13
167 0.17
168 0.21
169 0.26
170 0.27
171 0.29
172 0.32
173 0.37
174 0.35
175 0.33
176 0.33
177 0.3
178 0.3
179 0.28
180 0.23
181 0.17
182 0.15
183 0.15
184 0.1
185 0.08
186 0.06
187 0.05
188 0.05
189 0.04
190 0.06
191 0.07
192 0.09
193 0.16
194 0.22
195 0.24
196 0.28
197 0.38
198 0.45
199 0.5
200 0.57
201 0.59
202 0.59
203 0.58
204 0.56
205 0.46
206 0.44
207 0.4
208 0.33
209 0.26
210 0.26
211 0.3
212 0.29
213 0.36
214 0.31
215 0.3
216 0.28
217 0.27
218 0.21
219 0.18
220 0.18
221 0.11
222 0.13
223 0.11
224 0.11
225 0.1
226 0.1
227 0.11
228 0.1
229 0.11
230 0.09
231 0.12
232 0.13
233 0.13
234 0.13
235 0.11
236 0.11
237 0.11
238 0.12
239 0.09
240 0.09
241 0.17
242 0.17
243 0.19
244 0.19
245 0.19
246 0.25
247 0.32
248 0.31
249 0.27
250 0.29
251 0.28
252 0.29
253 0.3
254 0.3
255 0.29
256 0.34
257 0.35
258 0.39
259 0.43
260 0.44
261 0.45
262 0.37
263 0.32
264 0.27
265 0.33
266 0.28
267 0.24
268 0.22
269 0.17
270 0.18
271 0.17
272 0.16
273 0.07
274 0.06
275 0.06
276 0.05
277 0.05
278 0.04
279 0.04
280 0.04
281 0.07
282 0.11
283 0.13
284 0.18
285 0.19
286 0.24
287 0.32
288 0.41
289 0.48
290 0.55
291 0.64
292 0.7
293 0.8
294 0.85