Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FW27

Protein Details
Accession C5FW27    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-90FLSNSTKMRAKWRKKRVRRLKRKRRKTRARSKLFNRSVSHydrophilic
NLS Segment(s)
PositionSequence
59-84MRAKWRKKRVRRLKRKRRKTRARSKL
Subcellular Location(s) mito 13, nucl 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MTWVTSLASQSRLVCLVITHTYKDLYFLSFPSELLLPQPSSSTKKRYVGLCFLSNSTKMRAKWRKKRVRRLKRKRRKTRARSKLFNRSVSAKPPITMTETMIYRPVSVMSSPTGSIYDNRLLKPQPPPNIPFGNAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.16
4 0.19
5 0.2
6 0.2
7 0.2
8 0.21
9 0.21
10 0.23
11 0.2
12 0.16
13 0.15
14 0.14
15 0.17
16 0.16
17 0.16
18 0.15
19 0.15
20 0.12
21 0.13
22 0.15
23 0.11
24 0.11
25 0.13
26 0.14
27 0.19
28 0.24
29 0.28
30 0.32
31 0.36
32 0.4
33 0.43
34 0.45
35 0.46
36 0.46
37 0.43
38 0.38
39 0.35
40 0.33
41 0.3
42 0.26
43 0.23
44 0.24
45 0.22
46 0.32
47 0.4
48 0.49
49 0.58
50 0.68
51 0.75
52 0.8
53 0.9
54 0.91
55 0.92
56 0.93
57 0.94
58 0.95
59 0.95
60 0.96
61 0.96
62 0.96
63 0.96
64 0.96
65 0.95
66 0.95
67 0.94
68 0.92
69 0.89
70 0.89
71 0.84
72 0.78
73 0.69
74 0.64
75 0.57
76 0.52
77 0.5
78 0.39
79 0.33
80 0.3
81 0.29
82 0.27
83 0.25
84 0.22
85 0.2
86 0.2
87 0.2
88 0.22
89 0.21
90 0.16
91 0.16
92 0.14
93 0.11
94 0.11
95 0.12
96 0.11
97 0.13
98 0.13
99 0.13
100 0.13
101 0.13
102 0.14
103 0.17
104 0.22
105 0.24
106 0.25
107 0.29
108 0.31
109 0.35
110 0.43
111 0.47
112 0.49
113 0.52
114 0.55
115 0.57
116 0.6