Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VDX8

Protein Details
Accession A0A545VDX8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-78VPGRARRQSKREREGEREKGQBasic
NLS Segment(s)
PositionSequence
63-70RRQSKRER
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MHYALYPVQITAWRLGAGKAACRPSLHGWMDGGGQKVTGCGGVSRMVLERGSLFFLLVPGRARRQSKREREGEREKGQLSLPPQFPTRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.19
4 0.17
5 0.2
6 0.23
7 0.25
8 0.25
9 0.25
10 0.29
11 0.28
12 0.35
13 0.33
14 0.29
15 0.26
16 0.25
17 0.27
18 0.25
19 0.22
20 0.13
21 0.11
22 0.1
23 0.1
24 0.09
25 0.07
26 0.05
27 0.04
28 0.05
29 0.06
30 0.06
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.08
39 0.07
40 0.07
41 0.06
42 0.07
43 0.07
44 0.08
45 0.1
46 0.11
47 0.15
48 0.21
49 0.27
50 0.32
51 0.42
52 0.51
53 0.59
54 0.67
55 0.72
56 0.74
57 0.78
58 0.82
59 0.82
60 0.77
61 0.72
62 0.63
63 0.56
64 0.49
65 0.44
66 0.38
67 0.37
68 0.35
69 0.33