Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545V9M3

Protein Details
Accession A0A545V9M3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTPGVVRGKKRSRDRLQNRPLKEVHydrophilic
NLS Segment(s)
PositionSequence
9-11KKR
Subcellular Location(s) mito 12, nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MTPGVVRGKKRSRDRLQNRPLKEVGRGAVDATLEIEQSCESQYYRIYTRVTVSRARDLSTRVQNQDLGNTVVIVKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.88
5 0.82
6 0.77
7 0.7
8 0.6
9 0.54
10 0.46
11 0.37
12 0.3
13 0.27
14 0.21
15 0.18
16 0.16
17 0.13
18 0.11
19 0.09
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.06
26 0.05
27 0.05
28 0.06
29 0.08
30 0.1
31 0.12
32 0.15
33 0.16
34 0.16
35 0.2
36 0.23
37 0.26
38 0.28
39 0.3
40 0.34
41 0.34
42 0.35
43 0.34
44 0.33
45 0.38
46 0.41
47 0.44
48 0.4
49 0.41
50 0.43
51 0.42
52 0.42
53 0.36
54 0.29
55 0.23
56 0.2
57 0.18