Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5FYT1

Protein Details
Accession C5FYT1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-88TASIPRRDKTQEKKKRRRWRKPKPGRAQSQAGCBasic
NLS Segment(s)
PositionSequence
61-81RRDKTQEKKKRRRWRKPKPGR
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MPASDINCSFSGGGSACAASHPVKSQESREPGESKSPRGRVSELKPSVVFHQISSTASIPRRDKTQEKKKRRRWRKPKPGRAQSQAGCHEPGISFCCFVRRSRECLWVLHWKSVIPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.09
4 0.09
5 0.12
6 0.1
7 0.12
8 0.13
9 0.17
10 0.2
11 0.23
12 0.27
13 0.33
14 0.38
15 0.39
16 0.41
17 0.39
18 0.37
19 0.45
20 0.42
21 0.41
22 0.43
23 0.44
24 0.42
25 0.43
26 0.45
27 0.42
28 0.46
29 0.5
30 0.43
31 0.42
32 0.39
33 0.37
34 0.36
35 0.33
36 0.28
37 0.18
38 0.17
39 0.16
40 0.16
41 0.17
42 0.15
43 0.14
44 0.16
45 0.2
46 0.2
47 0.21
48 0.24
49 0.26
50 0.34
51 0.41
52 0.5
53 0.56
54 0.66
55 0.76
56 0.83
57 0.9
58 0.94
59 0.94
60 0.95
61 0.95
62 0.96
63 0.96
64 0.96
65 0.96
66 0.95
67 0.93
68 0.88
69 0.85
70 0.77
71 0.74
72 0.67
73 0.58
74 0.49
75 0.4
76 0.35
77 0.26
78 0.24
79 0.19
80 0.16
81 0.14
82 0.13
83 0.19
84 0.19
85 0.22
86 0.3
87 0.31
88 0.37
89 0.41
90 0.5
91 0.46
92 0.48
93 0.51
94 0.52
95 0.51
96 0.5
97 0.45