Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VXA2

Protein Details
Accession A0A545VXA2   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
109-130GSSSRSKHKPSSPPPPPPPNSGHydrophilic
183-204QSSWQKPPPQTGNKRPENPKPSHydrophilic
384-407DAFSYRPYDKPKRHQRRNSGGSMAHydrophilic
NLS Segment(s)
PositionSequence
181-181K
185-307SWQKPPPQTGNKRPENPKPSAKGSWEKARDEMRRKEEERKAKEAEQKRREELAKRLAELRAKEAKERVEREKEKQRKEKEIADKKAKEAKIAEAKIAAAKAAEVKAAAAKAAEAKAAAEKAKA
Subcellular Location(s) plas 9, mito 7, nucl 5.5, cyto_nucl 4, E.R. 2, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037651  Swc3  
Gene Ontology GO:0016020  C:membrane  
GO:0000812  C:Swr1 complex  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
Amino Acid Sequences MSAPPPPPPHGQMPRSGGLPPGKYDIFVIPEHSAGSGFLYLPSLQPNVNSFVAGFASALILVVLCQSMAPAFRAWWDSFEGLGNMGITLLIVGVGFGAWALGRTQNDPGSSSRSKHKPSSPPPPPPPNSGPSPGPAPGGYASSPPPNGPPPQSPPQPPPQPQPESPPPPPPPPPPHAGAEKPQSSWQKPPPQTGNKRPENPKPSAKGSWEKARDEMRRKEEERKAKEAEQKRREELAKRLAELRAKEAKERVEREKEKQRKEKEIADKKAKEAKIAEAKIAAAKAAEVKAAAAKAAEAKAAAEKAKAQAPPPPPSQAPTQTASSTANRAGSSYAFSGVGEKMSMWPNGKPPAPSTTSTAKAPPKSPDKPPPAPTAKTYVSTEEDAFSYRPYDKPKRHQRRNSGGSMASDGSWAPSHTTARTSPPPSMRGPYTTKDPDKIVIQAVYLFMNQYAKTPASQLISGVGSVTDGLILRITTEGLFIDDDVRGVPQREWDVKAWTLKLVEVWCPPHCLNSASASIPHPNNKSANLLYKMATGRARAGDRDPNKPFVGEEADVYLTDMLKACKDCCRLGLCEQKFGKTNTSGQSGEWKARGLHLLRATVRDQDGKRYLFVIDETENWKVGASLQRLRRGAQARQLGVCSMTASEAKNSLETLGWTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.53
3 0.48
4 0.44
5 0.41
6 0.41
7 0.35
8 0.35
9 0.32
10 0.31
11 0.33
12 0.29
13 0.26
14 0.24
15 0.26
16 0.21
17 0.21
18 0.21
19 0.19
20 0.16
21 0.13
22 0.14
23 0.11
24 0.1
25 0.09
26 0.11
27 0.11
28 0.12
29 0.15
30 0.15
31 0.14
32 0.16
33 0.18
34 0.21
35 0.21
36 0.2
37 0.17
38 0.17
39 0.17
40 0.15
41 0.12
42 0.07
43 0.07
44 0.07
45 0.07
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.07
56 0.08
57 0.09
58 0.09
59 0.12
60 0.17
61 0.18
62 0.19
63 0.21
64 0.2
65 0.2
66 0.21
67 0.19
68 0.15
69 0.15
70 0.13
71 0.09
72 0.08
73 0.07
74 0.05
75 0.04
76 0.03
77 0.03
78 0.03
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.03
87 0.04
88 0.08
89 0.1
90 0.12
91 0.16
92 0.19
93 0.2
94 0.21
95 0.23
96 0.27
97 0.3
98 0.31
99 0.37
100 0.43
101 0.48
102 0.53
103 0.6
104 0.63
105 0.69
106 0.77
107 0.77
108 0.8
109 0.83
110 0.85
111 0.8
112 0.77
113 0.74
114 0.67
115 0.63
116 0.57
117 0.49
118 0.41
119 0.41
120 0.34
121 0.3
122 0.25
123 0.22
124 0.18
125 0.19
126 0.17
127 0.15
128 0.16
129 0.18
130 0.19
131 0.17
132 0.2
133 0.22
134 0.25
135 0.28
136 0.31
137 0.35
138 0.43
139 0.48
140 0.5
141 0.51
142 0.57
143 0.62
144 0.61
145 0.62
146 0.63
147 0.63
148 0.6
149 0.63
150 0.63
151 0.62
152 0.61
153 0.62
154 0.58
155 0.58
156 0.61
157 0.61
158 0.59
159 0.55
160 0.56
161 0.5
162 0.49
163 0.48
164 0.46
165 0.44
166 0.45
167 0.42
168 0.39
169 0.43
170 0.46
171 0.43
172 0.48
173 0.5
174 0.53
175 0.54
176 0.61
177 0.64
178 0.67
179 0.74
180 0.76
181 0.78
182 0.76
183 0.81
184 0.8
185 0.8
186 0.76
187 0.73
188 0.71
189 0.67
190 0.64
191 0.6
192 0.59
193 0.57
194 0.55
195 0.58
196 0.55
197 0.51
198 0.5
199 0.54
200 0.57
201 0.58
202 0.61
203 0.58
204 0.61
205 0.63
206 0.68
207 0.68
208 0.7
209 0.68
210 0.66
211 0.63
212 0.62
213 0.68
214 0.67
215 0.69
216 0.68
217 0.67
218 0.64
219 0.65
220 0.62
221 0.58
222 0.56
223 0.55
224 0.49
225 0.44
226 0.44
227 0.41
228 0.41
229 0.36
230 0.36
231 0.33
232 0.32
233 0.33
234 0.34
235 0.37
236 0.4
237 0.44
238 0.45
239 0.48
240 0.51
241 0.56
242 0.64
243 0.66
244 0.69
245 0.73
246 0.72
247 0.71
248 0.72
249 0.73
250 0.74
251 0.75
252 0.74
253 0.75
254 0.7
255 0.65
256 0.68
257 0.59
258 0.51
259 0.42
260 0.41
261 0.39
262 0.38
263 0.34
264 0.27
265 0.27
266 0.25
267 0.23
268 0.16
269 0.07
270 0.06
271 0.07
272 0.07
273 0.07
274 0.06
275 0.06
276 0.07
277 0.07
278 0.07
279 0.05
280 0.05
281 0.06
282 0.07
283 0.07
284 0.05
285 0.06
286 0.07
287 0.08
288 0.09
289 0.07
290 0.08
291 0.1
292 0.14
293 0.15
294 0.14
295 0.19
296 0.24
297 0.28
298 0.29
299 0.31
300 0.27
301 0.28
302 0.32
303 0.3
304 0.28
305 0.26
306 0.25
307 0.22
308 0.24
309 0.24
310 0.21
311 0.18
312 0.16
313 0.15
314 0.13
315 0.13
316 0.13
317 0.11
318 0.11
319 0.1
320 0.09
321 0.08
322 0.08
323 0.09
324 0.08
325 0.08
326 0.06
327 0.06
328 0.07
329 0.09
330 0.11
331 0.11
332 0.12
333 0.16
334 0.2
335 0.21
336 0.2
337 0.19
338 0.22
339 0.24
340 0.25
341 0.25
342 0.26
343 0.27
344 0.27
345 0.31
346 0.31
347 0.31
348 0.32
349 0.34
350 0.38
351 0.4
352 0.46
353 0.5
354 0.54
355 0.58
356 0.59
357 0.61
358 0.59
359 0.56
360 0.51
361 0.48
362 0.41
363 0.37
364 0.34
365 0.28
366 0.25
367 0.25
368 0.23
369 0.17
370 0.16
371 0.15
372 0.14
373 0.11
374 0.11
375 0.11
376 0.13
377 0.21
378 0.3
379 0.36
380 0.47
381 0.58
382 0.68
383 0.77
384 0.83
385 0.86
386 0.87
387 0.87
388 0.81
389 0.73
390 0.63
391 0.53
392 0.46
393 0.36
394 0.25
395 0.18
396 0.14
397 0.11
398 0.09
399 0.09
400 0.08
401 0.09
402 0.11
403 0.11
404 0.14
405 0.14
406 0.2
407 0.26
408 0.27
409 0.3
410 0.33
411 0.36
412 0.35
413 0.38
414 0.34
415 0.33
416 0.35
417 0.32
418 0.36
419 0.4
420 0.4
421 0.38
422 0.38
423 0.35
424 0.33
425 0.32
426 0.26
427 0.19
428 0.17
429 0.15
430 0.14
431 0.13
432 0.11
433 0.09
434 0.08
435 0.09
436 0.09
437 0.1
438 0.11
439 0.11
440 0.12
441 0.13
442 0.16
443 0.16
444 0.16
445 0.15
446 0.14
447 0.14
448 0.13
449 0.12
450 0.08
451 0.06
452 0.06
453 0.06
454 0.04
455 0.04
456 0.04
457 0.05
458 0.05
459 0.05
460 0.05
461 0.06
462 0.05
463 0.06
464 0.05
465 0.06
466 0.06
467 0.06
468 0.07
469 0.07
470 0.07
471 0.07
472 0.08
473 0.08
474 0.1
475 0.1
476 0.13
477 0.18
478 0.22
479 0.25
480 0.26
481 0.29
482 0.31
483 0.35
484 0.32
485 0.28
486 0.25
487 0.22
488 0.23
489 0.2
490 0.2
491 0.2
492 0.24
493 0.23
494 0.28
495 0.27
496 0.27
497 0.27
498 0.25
499 0.23
500 0.23
501 0.24
502 0.2
503 0.22
504 0.21
505 0.25
506 0.27
507 0.32
508 0.31
509 0.33
510 0.34
511 0.34
512 0.37
513 0.35
514 0.39
515 0.37
516 0.36
517 0.32
518 0.34
519 0.33
520 0.32
521 0.31
522 0.24
523 0.24
524 0.27
525 0.29
526 0.26
527 0.3
528 0.36
529 0.38
530 0.46
531 0.46
532 0.46
533 0.45
534 0.43
535 0.39
536 0.33
537 0.34
538 0.25
539 0.22
540 0.2
541 0.19
542 0.19
543 0.19
544 0.16
545 0.1
546 0.11
547 0.11
548 0.1
549 0.13
550 0.15
551 0.16
552 0.22
553 0.26
554 0.27
555 0.3
556 0.34
557 0.35
558 0.42
559 0.51
560 0.46
561 0.51
562 0.51
563 0.51
564 0.51
565 0.49
566 0.47
567 0.4
568 0.44
569 0.4
570 0.44
571 0.4
572 0.36
573 0.43
574 0.4
575 0.41
576 0.36
577 0.33
578 0.28
579 0.3
580 0.36
581 0.29
582 0.33
583 0.33
584 0.38
585 0.38
586 0.41
587 0.4
588 0.38
589 0.39
590 0.4
591 0.37
592 0.4
593 0.45
594 0.43
595 0.43
596 0.39
597 0.36
598 0.29
599 0.29
600 0.24
601 0.19
602 0.21
603 0.24
604 0.24
605 0.24
606 0.22
607 0.21
608 0.17
609 0.2
610 0.24
611 0.26
612 0.32
613 0.39
614 0.47
615 0.49
616 0.51
617 0.54
618 0.53
619 0.54
620 0.55
621 0.57
622 0.52
623 0.53
624 0.53
625 0.46
626 0.4
627 0.34
628 0.25
629 0.17
630 0.16
631 0.15
632 0.15
633 0.17
634 0.19
635 0.2
636 0.2
637 0.2
638 0.19
639 0.17