Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FSG8

Protein Details
Accession C5FSG8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-75SKTVRRRGGGRRRRRDEQTKDWLDVGRSKEKKRRKGKKKEKEKLSWPCLGKBasic
NLS Segment(s)
PositionSequence
28-67VRRRGGGRRRRRDEQTKDWLDVGRSKEKKRRKGKKKEKEK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MRRQRACDEHRCSSSSGRKVEQEDSKTVRRRGGGRRRRRDEQTKDWLDVGRSKEKKRRKGKKKEKEKLSWPCLGKLKMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.51
4 0.47
5 0.48
6 0.49
7 0.53
8 0.52
9 0.47
10 0.46
11 0.46
12 0.51
13 0.53
14 0.52
15 0.48
16 0.44
17 0.47
18 0.51
19 0.57
20 0.59
21 0.64
22 0.72
23 0.76
24 0.79
25 0.81
26 0.81
27 0.78
28 0.77
29 0.76
30 0.68
31 0.62
32 0.57
33 0.49
34 0.41
35 0.37
36 0.33
37 0.32
38 0.34
39 0.4
40 0.47
41 0.56
42 0.65
43 0.71
44 0.78
45 0.79
46 0.85
47 0.9
48 0.92
49 0.95
50 0.95
51 0.94
52 0.93
53 0.92
54 0.91
55 0.87
56 0.84
57 0.75
58 0.72
59 0.7