Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4L0U0

Protein Details
Accession A0A4S4L0U0   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
92-114GEHEKVRWDKKERKIHAVKEGRABasic
NLS Segment(s)
PositionSequence
101-111KKERKIHAVKE
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MVFVGWPSRLNMASSVPRLIGWAGLHDMTQEEKPEPRGAVARSQAWIGRSASVGKEGLQCDGEWMMTRSRGKAVMEPVGTSWRVMSEEGGAGEHEKVRWDKKERKIHAVKEGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.23
4 0.22
5 0.22
6 0.2
7 0.18
8 0.12
9 0.12
10 0.12
11 0.12
12 0.12
13 0.11
14 0.12
15 0.11
16 0.12
17 0.12
18 0.12
19 0.13
20 0.16
21 0.19
22 0.18
23 0.17
24 0.2
25 0.2
26 0.24
27 0.25
28 0.24
29 0.22
30 0.23
31 0.22
32 0.19
33 0.2
34 0.15
35 0.13
36 0.12
37 0.13
38 0.12
39 0.12
40 0.12
41 0.1
42 0.13
43 0.12
44 0.12
45 0.12
46 0.11
47 0.1
48 0.1
49 0.09
50 0.07
51 0.08
52 0.08
53 0.12
54 0.12
55 0.13
56 0.14
57 0.16
58 0.17
59 0.19
60 0.22
61 0.23
62 0.23
63 0.22
64 0.22
65 0.22
66 0.22
67 0.18
68 0.15
69 0.1
70 0.11
71 0.11
72 0.11
73 0.09
74 0.1
75 0.1
76 0.1
77 0.1
78 0.1
79 0.11
80 0.11
81 0.1
82 0.13
83 0.17
84 0.23
85 0.31
86 0.4
87 0.48
88 0.57
89 0.68
90 0.7
91 0.77
92 0.8
93 0.79
94 0.81