Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FK60

Protein Details
Accession C5FK60   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
159-181GSENASSKKRAKLRKQKGLLASLHydrophilic
NLS Segment(s)
PositionSequence
166-175KKRAKLRKQK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MSRPLSIRLDFLKNSAHFLSLRSPSTSAYLMTARSNIIVFDGSSYTTTGDETEACPACGSIRTPGVNSRVFTRTEAPPKPTRLMQKPQHEAPSKTPSMQRCVVYECTRCKHEVVQHLPQPTRQRRRRDLPIAPSVNPSMPSNTGMSQIASTGSGASKTGSENASSKKRAKLRKQKGLLASLSTEKQRSQLQSKPANSLDLMDFFQST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.3
4 0.25
5 0.26
6 0.31
7 0.28
8 0.3
9 0.28
10 0.28
11 0.27
12 0.3
13 0.28
14 0.21
15 0.19
16 0.18
17 0.17
18 0.18
19 0.18
20 0.15
21 0.15
22 0.14
23 0.11
24 0.11
25 0.1
26 0.08
27 0.09
28 0.09
29 0.09
30 0.09
31 0.1
32 0.09
33 0.09
34 0.09
35 0.08
36 0.08
37 0.08
38 0.08
39 0.14
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.13
46 0.14
47 0.12
48 0.15
49 0.16
50 0.17
51 0.21
52 0.26
53 0.27
54 0.26
55 0.27
56 0.26
57 0.26
58 0.27
59 0.26
60 0.28
61 0.33
62 0.36
63 0.38
64 0.41
65 0.43
66 0.44
67 0.45
68 0.47
69 0.46
70 0.52
71 0.55
72 0.58
73 0.6
74 0.61
75 0.65
76 0.61
77 0.56
78 0.52
79 0.51
80 0.43
81 0.39
82 0.4
83 0.34
84 0.35
85 0.36
86 0.31
87 0.25
88 0.28
89 0.3
90 0.3
91 0.32
92 0.31
93 0.3
94 0.31
95 0.31
96 0.28
97 0.28
98 0.29
99 0.33
100 0.35
101 0.4
102 0.42
103 0.45
104 0.45
105 0.45
106 0.49
107 0.5
108 0.54
109 0.55
110 0.6
111 0.65
112 0.73
113 0.78
114 0.78
115 0.75
116 0.72
117 0.74
118 0.68
119 0.6
120 0.54
121 0.46
122 0.38
123 0.32
124 0.25
125 0.18
126 0.16
127 0.16
128 0.16
129 0.15
130 0.16
131 0.15
132 0.15
133 0.12
134 0.11
135 0.1
136 0.09
137 0.08
138 0.07
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.08
145 0.11
146 0.11
147 0.13
148 0.16
149 0.23
150 0.3
151 0.34
152 0.38
153 0.43
154 0.5
155 0.59
156 0.66
157 0.71
158 0.75
159 0.8
160 0.83
161 0.83
162 0.82
163 0.78
164 0.69
165 0.6
166 0.52
167 0.45
168 0.41
169 0.37
170 0.32
171 0.26
172 0.28
173 0.31
174 0.35
175 0.38
176 0.41
177 0.48
178 0.55
179 0.58
180 0.61
181 0.56
182 0.52
183 0.46
184 0.42
185 0.35
186 0.28
187 0.26