Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4M0F5

Protein Details
Accession A0A4S4M0F5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-36PPPSSGGKAAKKKKWSKGKVKDKAQHAVMHydrophilic
NLS Segment(s)
PositionSequence
4-30AKAAPPPSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 10, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPPPSSGGKAAKKKKWSKGKVKDKAQHAVMIDKPTYDRILKEVPTFRFISQSILIERLKVNGSLARVAIRHLEKEGSIKRIVHHHGQLIYSKCFVLAHADGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.58
4 0.6
5 0.66
6 0.72
7 0.79
8 0.82
9 0.83
10 0.85
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.81
18 0.71
19 0.64
20 0.53
21 0.48
22 0.4
23 0.36
24 0.29
25 0.22
26 0.21
27 0.19
28 0.2
29 0.17
30 0.14
31 0.14
32 0.18
33 0.19
34 0.22
35 0.27
36 0.26
37 0.28
38 0.29
39 0.26
40 0.25
41 0.24
42 0.22
43 0.18
44 0.18
45 0.15
46 0.17
47 0.17
48 0.15
49 0.15
50 0.14
51 0.13
52 0.12
53 0.12
54 0.1
55 0.12
56 0.12
57 0.12
58 0.12
59 0.11
60 0.12
61 0.17
62 0.16
63 0.16
64 0.16
65 0.17
66 0.16
67 0.23
68 0.26
69 0.25
70 0.27
71 0.27
72 0.27
73 0.34
74 0.38
75 0.37
76 0.37
77 0.38
78 0.37
79 0.38
80 0.43
81 0.4
82 0.38
83 0.32
84 0.28
85 0.24
86 0.22
87 0.2
88 0.2
89 0.17