Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3XBU0

Protein Details
Accession A0A4V3XBU0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-43EHAPISQKNVPKKRRKKNSQECVMSPHydrophilic
NLS Segment(s)
PositionSequence
25-34KNVPKKRRKK
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MTRIHGWHRRHSGRPAYEHAPISQKNVPKKRRKKNSQECVMSPDAAQLVITDPIVARHPEGIRELALLLNREQDIALHAEHECGGVRERAEARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.61
4 0.59
5 0.54
6 0.47
7 0.44
8 0.38
9 0.38
10 0.37
11 0.38
12 0.42
13 0.51
14 0.58
15 0.62
16 0.72
17 0.77
18 0.84
19 0.89
20 0.91
21 0.92
22 0.93
23 0.92
24 0.87
25 0.77
26 0.72
27 0.62
28 0.51
29 0.4
30 0.3
31 0.2
32 0.14
33 0.12
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.04
40 0.06
41 0.07
42 0.07
43 0.07
44 0.1
45 0.11
46 0.12
47 0.14
48 0.14
49 0.13
50 0.13
51 0.13
52 0.11
53 0.12
54 0.12
55 0.11
56 0.13
57 0.12
58 0.12
59 0.12
60 0.1
61 0.11
62 0.11
63 0.11
64 0.1
65 0.1
66 0.1
67 0.1
68 0.11
69 0.1
70 0.09
71 0.12
72 0.13
73 0.13
74 0.19