Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4LQA0

Protein Details
Accession A0A4S4LQA0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-105TTSQHIRRRVWFNRRPRSRRIPPDRGTIEHydrophilic
NLS Segment(s)
PositionSequence
90-95RRPRSR
Subcellular Location(s) mito 11, cyto 7, nucl 6, extr 2
Family & Domain DBs
Amino Acid Sequences MVKMSATTVITASPSVSNVQPSNSGSVISLSTRPTALAPGLLVASAATTIQDTISVTFPITTWTLRRSRVFLPTPTTTSQHIRRRVWFNRRPRSRRIPPDRGTIEAWIQHLVNVNVNPAITEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.17
5 0.16
6 0.18
7 0.2
8 0.2
9 0.23
10 0.2
11 0.2
12 0.16
13 0.16
14 0.15
15 0.13
16 0.14
17 0.12
18 0.13
19 0.12
20 0.12
21 0.12
22 0.12
23 0.11
24 0.09
25 0.08
26 0.07
27 0.07
28 0.07
29 0.06
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.08
48 0.08
49 0.08
50 0.12
51 0.15
52 0.19
53 0.2
54 0.22
55 0.24
56 0.31
57 0.33
58 0.32
59 0.35
60 0.34
61 0.36
62 0.34
63 0.34
64 0.29
65 0.32
66 0.38
67 0.41
68 0.46
69 0.47
70 0.52
71 0.59
72 0.66
73 0.7
74 0.7
75 0.72
76 0.75
77 0.83
78 0.81
79 0.81
80 0.83
81 0.83
82 0.85
83 0.85
84 0.85
85 0.78
86 0.83
87 0.76
88 0.69
89 0.61
90 0.52
91 0.45
92 0.37
93 0.34
94 0.26
95 0.22
96 0.2
97 0.22
98 0.21
99 0.22
100 0.2
101 0.21
102 0.2
103 0.19