Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4M6I6

Protein Details
Accession A0A4S4M6I6    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
197-228FVEPVKRESKKERKEKKDREKRERKQKELEELBasic
NLS Segment(s)
PositionSequence
93-111GKGAKGKSDDSAKGKKRKV
122-137PKTKKAKPATKVTKGR
202-224KRESKKERKEKKDREKRERKQKE
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013243  SCA7_dom  
IPR037804  SGF73  
Gene Ontology GO:0000124  C:SAGA complex  
Pfam View protein in Pfam  
PF08313  SCA7  
PROSITE View protein in PROSITE  
PS51505  SCA7  
Amino Acid Sequences MLKLKPSPAPSPAPFSFENLPSTPPPISPSTSVSNLPSPPTSWLSAQEMKVFGADPLRSTSDIGVVQCKECGKPVLRSAAADHAENCKNVRLGKGAKGKSDDSAKGKKRKVEELDPADLDAPKTKKAKPATKVTKGRFKGPVDLDRQCGVINDKNLPCSRSLTCKSHSMGAKRALAGRSRPYDELLLDWRRANDPSFVEPVKRESKKERKEKKDREKRERKQKELEELAKKNGIDLTKPGAEAQLEQLKASTKKKKTTTSAVTAAGGGASSGATASARAAAVDEDLALENLAEVDSEAELDSMTKSVRVAQERGILGVPLTTPCDAGSWFVVRRERLRNCRDLFAGALMKGGISSVASAGAAARLGTGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.42
4 0.37
5 0.38
6 0.31
7 0.34
8 0.3
9 0.33
10 0.29
11 0.25
12 0.27
13 0.25
14 0.28
15 0.27
16 0.3
17 0.31
18 0.33
19 0.34
20 0.34
21 0.35
22 0.33
23 0.33
24 0.3
25 0.26
26 0.28
27 0.29
28 0.28
29 0.25
30 0.27
31 0.31
32 0.35
33 0.35
34 0.34
35 0.32
36 0.29
37 0.28
38 0.25
39 0.19
40 0.18
41 0.17
42 0.15
43 0.18
44 0.2
45 0.2
46 0.2
47 0.2
48 0.18
49 0.2
50 0.2
51 0.22
52 0.21
53 0.2
54 0.22
55 0.23
56 0.2
57 0.21
58 0.26
59 0.24
60 0.28
61 0.33
62 0.38
63 0.38
64 0.38
65 0.38
66 0.4
67 0.37
68 0.32
69 0.29
70 0.28
71 0.29
72 0.29
73 0.28
74 0.23
75 0.24
76 0.24
77 0.25
78 0.25
79 0.26
80 0.34
81 0.42
82 0.42
83 0.43
84 0.46
85 0.45
86 0.42
87 0.45
88 0.41
89 0.39
90 0.46
91 0.51
92 0.56
93 0.59
94 0.6
95 0.59
96 0.63
97 0.63
98 0.62
99 0.63
100 0.6
101 0.6
102 0.55
103 0.51
104 0.42
105 0.36
106 0.28
107 0.24
108 0.19
109 0.2
110 0.23
111 0.25
112 0.31
113 0.4
114 0.48
115 0.49
116 0.59
117 0.63
118 0.7
119 0.77
120 0.76
121 0.77
122 0.7
123 0.69
124 0.66
125 0.58
126 0.55
127 0.51
128 0.52
129 0.48
130 0.49
131 0.45
132 0.38
133 0.37
134 0.29
135 0.24
136 0.21
137 0.18
138 0.18
139 0.22
140 0.22
141 0.26
142 0.27
143 0.26
144 0.24
145 0.24
146 0.24
147 0.26
148 0.3
149 0.31
150 0.32
151 0.36
152 0.36
153 0.38
154 0.41
155 0.36
156 0.36
157 0.37
158 0.37
159 0.32
160 0.35
161 0.3
162 0.29
163 0.29
164 0.28
165 0.26
166 0.27
167 0.27
168 0.25
169 0.24
170 0.21
171 0.2
172 0.2
173 0.19
174 0.18
175 0.18
176 0.17
177 0.18
178 0.18
179 0.18
180 0.15
181 0.15
182 0.16
183 0.19
184 0.19
185 0.19
186 0.18
187 0.23
188 0.28
189 0.28
190 0.29
191 0.36
192 0.47
193 0.55
194 0.65
195 0.71
196 0.73
197 0.82
198 0.9
199 0.91
200 0.92
201 0.93
202 0.93
203 0.94
204 0.93
205 0.94
206 0.93
207 0.88
208 0.87
209 0.82
210 0.8
211 0.77
212 0.75
213 0.73
214 0.65
215 0.6
216 0.53
217 0.47
218 0.39
219 0.33
220 0.25
221 0.17
222 0.17
223 0.19
224 0.17
225 0.17
226 0.17
227 0.15
228 0.15
229 0.14
230 0.17
231 0.17
232 0.16
233 0.16
234 0.17
235 0.2
236 0.24
237 0.31
238 0.36
239 0.37
240 0.46
241 0.53
242 0.6
243 0.62
244 0.67
245 0.67
246 0.64
247 0.62
248 0.55
249 0.49
250 0.41
251 0.34
252 0.24
253 0.17
254 0.09
255 0.05
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.04
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.05
272 0.06
273 0.06
274 0.05
275 0.05
276 0.05
277 0.05
278 0.05
279 0.04
280 0.03
281 0.04
282 0.04
283 0.04
284 0.05
285 0.04
286 0.05
287 0.05
288 0.06
289 0.06
290 0.06
291 0.06
292 0.07
293 0.12
294 0.18
295 0.22
296 0.24
297 0.27
298 0.34
299 0.34
300 0.35
301 0.31
302 0.25
303 0.2
304 0.19
305 0.15
306 0.1
307 0.12
308 0.1
309 0.1
310 0.1
311 0.11
312 0.11
313 0.12
314 0.14
315 0.16
316 0.18
317 0.23
318 0.29
319 0.31
320 0.38
321 0.46
322 0.53
323 0.59
324 0.65
325 0.7
326 0.68
327 0.7
328 0.65
329 0.57
330 0.49
331 0.44
332 0.4
333 0.3
334 0.27
335 0.21
336 0.19
337 0.16
338 0.14
339 0.09
340 0.05
341 0.06
342 0.05
343 0.06
344 0.06
345 0.06
346 0.06
347 0.07
348 0.07
349 0.06
350 0.06