Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V3XD24

Protein Details
Accession A0A4V3XD24    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
98-118ASAVRDKTEQRRERKVPRGFVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
Amino Acid Sequences MHFLPPVRLFATQAPSPANPSSSSSSSSTPSSTTAEPNTHFRITSRRSAISLPAHIKGTLVSLGIHRRMQTVYHRHTPETAGKILAVKELVEVENVPASAVRDKTEQRRERKVPRGFVVVRSKLNSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.3
4 0.29
5 0.26
6 0.21
7 0.24
8 0.27
9 0.25
10 0.28
11 0.26
12 0.27
13 0.27
14 0.27
15 0.24
16 0.2
17 0.2
18 0.2
19 0.19
20 0.2
21 0.21
22 0.22
23 0.24
24 0.28
25 0.3
26 0.28
27 0.27
28 0.25
29 0.3
30 0.31
31 0.36
32 0.35
33 0.32
34 0.32
35 0.33
36 0.38
37 0.32
38 0.34
39 0.28
40 0.26
41 0.25
42 0.24
43 0.23
44 0.17
45 0.15
46 0.1
47 0.08
48 0.07
49 0.08
50 0.1
51 0.12
52 0.13
53 0.12
54 0.13
55 0.13
56 0.15
57 0.21
58 0.27
59 0.31
60 0.38
61 0.39
62 0.39
63 0.39
64 0.4
65 0.38
66 0.33
67 0.29
68 0.21
69 0.2
70 0.21
71 0.2
72 0.18
73 0.12
74 0.08
75 0.08
76 0.09
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.09
86 0.12
87 0.12
88 0.14
89 0.17
90 0.23
91 0.32
92 0.43
93 0.49
94 0.54
95 0.64
96 0.71
97 0.77
98 0.82
99 0.81
100 0.79
101 0.76
102 0.77
103 0.69
104 0.69
105 0.69
106 0.65
107 0.61
108 0.55