Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75AX0

Protein Details
Accession Q75AX0   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-36QPDYSRQELSRKDKRRHNIESKVAKISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005829  C:cytosol  
GO:0033698  C:Rpd3L complex  
GO:0070822  C:Sin3-type complex  
GO:0004407  F:histone deacetylase activity  
GO:0042826  F:histone deacetylase binding  
GO:0043709  P:cell adhesion involved in single-species biofilm formation  
GO:0031507  P:heterochromatin formation  
GO:0016575  P:histone deacetylation  
GO:0061188  P:negative regulation of rDNA heterochromatin formation  
GO:0061186  P:negative regulation of silent mating-type cassette heterochromatin formation  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0061408  P:positive regulation of transcription from RNA polymerase II promoter in response to heat stress  
GO:2000217  P:regulation of invasive growth in response to glucose limitation  
KEGG ago:AGOS_ADL200C  -  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MSFQGYDQYQPDYSRQELSRKDKRRHNIESKVAKISQNFVVDKDVHYRDRLTHLQTDLTSLHQGNNLQFMRMLRDLEEERDLELIRLRFYEEYRVQRSSIEFQEDIEKTKEEHEKMIKLCKEKLYESFEKKIIKLQEERLLTDVANAHSYSMDHPRTKQAKPTRSLQSAWDSSTSELGGGTGAGGASANESGTETGAERRSLRKRVTNNAAARIINEESEYVSNRDSSGPYGGSRTGTGSAANAAMAGGSQNNSDSEFLQYISDSNELYTLLFGSEERDTEKKKLRSTQRLSTKSAPPLQSLTPDEVTEDIALIRQLTGQPPAPFRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.4
4 0.47
5 0.55
6 0.61
7 0.66
8 0.73
9 0.76
10 0.82
11 0.84
12 0.86
13 0.86
14 0.86
15 0.86
16 0.87
17 0.82
18 0.79
19 0.72
20 0.65
21 0.56
22 0.5
23 0.46
24 0.43
25 0.39
26 0.33
27 0.34
28 0.31
29 0.31
30 0.35
31 0.34
32 0.29
33 0.31
34 0.31
35 0.3
36 0.36
37 0.39
38 0.36
39 0.37
40 0.36
41 0.37
42 0.35
43 0.36
44 0.29
45 0.26
46 0.25
47 0.2
48 0.2
49 0.19
50 0.22
51 0.19
52 0.27
53 0.25
54 0.22
55 0.23
56 0.22
57 0.25
58 0.24
59 0.24
60 0.17
61 0.21
62 0.22
63 0.23
64 0.25
65 0.2
66 0.19
67 0.2
68 0.19
69 0.14
70 0.18
71 0.16
72 0.14
73 0.14
74 0.15
75 0.15
76 0.16
77 0.24
78 0.26
79 0.32
80 0.36
81 0.38
82 0.36
83 0.36
84 0.38
85 0.35
86 0.31
87 0.29
88 0.24
89 0.23
90 0.3
91 0.29
92 0.29
93 0.25
94 0.23
95 0.19
96 0.25
97 0.3
98 0.23
99 0.29
100 0.3
101 0.34
102 0.35
103 0.43
104 0.41
105 0.39
106 0.42
107 0.41
108 0.4
109 0.37
110 0.4
111 0.39
112 0.43
113 0.45
114 0.45
115 0.44
116 0.43
117 0.41
118 0.41
119 0.36
120 0.33
121 0.32
122 0.33
123 0.35
124 0.34
125 0.35
126 0.31
127 0.28
128 0.23
129 0.21
130 0.18
131 0.12
132 0.12
133 0.11
134 0.1
135 0.09
136 0.1
137 0.1
138 0.15
139 0.18
140 0.18
141 0.19
142 0.28
143 0.33
144 0.34
145 0.41
146 0.43
147 0.47
148 0.49
149 0.55
150 0.53
151 0.51
152 0.51
153 0.45
154 0.42
155 0.36
156 0.34
157 0.28
158 0.21
159 0.19
160 0.18
161 0.15
162 0.09
163 0.07
164 0.06
165 0.05
166 0.04
167 0.03
168 0.03
169 0.03
170 0.02
171 0.02
172 0.02
173 0.03
174 0.03
175 0.03
176 0.03
177 0.04
178 0.04
179 0.04
180 0.05
181 0.05
182 0.08
183 0.1
184 0.11
185 0.12
186 0.2
187 0.26
188 0.32
189 0.36
190 0.4
191 0.45
192 0.52
193 0.59
194 0.61
195 0.58
196 0.57
197 0.56
198 0.48
199 0.43
200 0.37
201 0.29
202 0.21
203 0.17
204 0.12
205 0.1
206 0.12
207 0.13
208 0.11
209 0.11
210 0.11
211 0.11
212 0.13
213 0.12
214 0.12
215 0.13
216 0.13
217 0.13
218 0.15
219 0.15
220 0.15
221 0.14
222 0.14
223 0.13
224 0.13
225 0.12
226 0.11
227 0.11
228 0.1
229 0.09
230 0.07
231 0.05
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.05
238 0.06
239 0.06
240 0.08
241 0.09
242 0.09
243 0.12
244 0.12
245 0.12
246 0.12
247 0.12
248 0.11
249 0.12
250 0.13
251 0.1
252 0.09
253 0.09
254 0.09
255 0.09
256 0.08
257 0.07
258 0.06
259 0.06
260 0.06
261 0.08
262 0.09
263 0.1
264 0.14
265 0.18
266 0.22
267 0.3
268 0.39
269 0.43
270 0.49
271 0.58
272 0.65
273 0.71
274 0.75
275 0.78
276 0.79
277 0.79
278 0.78
279 0.76
280 0.73
281 0.7
282 0.7
283 0.62
284 0.54
285 0.53
286 0.48
287 0.47
288 0.42
289 0.39
290 0.33
291 0.3
292 0.28
293 0.25
294 0.25
295 0.19
296 0.16
297 0.1
298 0.1
299 0.1
300 0.09
301 0.09
302 0.09
303 0.11
304 0.13
305 0.18
306 0.23
307 0.27