Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4M5W9

Protein Details
Accession A0A4S4M5W9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-95AQTPSLQPRRRDRAKRHSNDGAHydrophilic
NLS Segment(s)
PositionSequence
82-88RRRDRAK
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
Amino Acid Sequences MNFLPPTRNIGSHSQRARFRSPKILPTRPSTGICLFPIREGAGCTGHSHTATLRTYTTQAFSLTIPPARQRRAAQTPSLQPRRRDRAKRHSNDGAAQPLRCMPAADTLCILPPPSVSTGVDQPPPASVKICPRFRSENRAFFFFXXVWFGLADSSTRFTRSIFNLRVFASNSKSEKVGIYCNTPGSQEAYMQEATQRDGRGETSCGDRAMGGLTSGPGTDEHLAPESKFGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.63
4 0.69
5 0.66
6 0.64
7 0.66
8 0.64
9 0.66
10 0.7
11 0.73
12 0.68
13 0.67
14 0.69
15 0.63
16 0.59
17 0.54
18 0.47
19 0.42
20 0.39
21 0.37
22 0.31
23 0.27
24 0.26
25 0.22
26 0.2
27 0.18
28 0.18
29 0.15
30 0.15
31 0.16
32 0.17
33 0.17
34 0.17
35 0.16
36 0.15
37 0.19
38 0.2
39 0.19
40 0.18
41 0.18
42 0.2
43 0.21
44 0.21
45 0.16
46 0.16
47 0.15
48 0.15
49 0.16
50 0.17
51 0.18
52 0.17
53 0.23
54 0.28
55 0.29
56 0.34
57 0.33
58 0.39
59 0.46
60 0.49
61 0.47
62 0.47
63 0.53
64 0.58
65 0.65
66 0.62
67 0.59
68 0.65
69 0.7
70 0.74
71 0.75
72 0.75
73 0.76
74 0.82
75 0.82
76 0.8
77 0.77
78 0.7
79 0.64
80 0.57
81 0.54
82 0.44
83 0.38
84 0.3
85 0.25
86 0.23
87 0.19
88 0.16
89 0.09
90 0.15
91 0.16
92 0.16
93 0.15
94 0.14
95 0.15
96 0.14
97 0.14
98 0.06
99 0.05
100 0.06
101 0.07
102 0.08
103 0.08
104 0.09
105 0.12
106 0.14
107 0.15
108 0.14
109 0.13
110 0.13
111 0.14
112 0.13
113 0.11
114 0.11
115 0.2
116 0.28
117 0.34
118 0.34
119 0.38
120 0.46
121 0.48
122 0.56
123 0.54
124 0.54
125 0.51
126 0.52
127 0.49
128 0.41
129 0.4
130 0.29
131 0.22
132 0.14
133 0.12
134 0.09
135 0.08
136 0.08
137 0.06
138 0.07
139 0.1
140 0.09
141 0.11
142 0.11
143 0.11
144 0.16
145 0.21
146 0.29
147 0.3
148 0.32
149 0.33
150 0.34
151 0.36
152 0.34
153 0.32
154 0.27
155 0.29
156 0.29
157 0.27
158 0.27
159 0.25
160 0.25
161 0.24
162 0.27
163 0.22
164 0.25
165 0.25
166 0.27
167 0.27
168 0.25
169 0.24
170 0.21
171 0.19
172 0.17
173 0.16
174 0.17
175 0.17
176 0.16
177 0.18
178 0.16
179 0.18
180 0.2
181 0.19
182 0.17
183 0.18
184 0.19
185 0.19
186 0.2
187 0.19
188 0.21
189 0.23
190 0.22
191 0.21
192 0.19
193 0.17
194 0.17
195 0.16
196 0.1
197 0.09
198 0.09
199 0.09
200 0.09
201 0.09
202 0.07
203 0.11
204 0.13
205 0.13
206 0.14
207 0.17
208 0.19
209 0.18