Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4LPJ9

Protein Details
Accession A0A4S4LPJ9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-50KDEYLEGKKKQREKKQDEKEKEFKLBasic
NLS Segment(s)
PositionSequence
33-40KKKQREKK
Subcellular Location(s) nucl 16.5, cyto_nucl 15.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MLATLRELIQAGIRQGDVAEDDDNDKDEYLEGKKKQREKKQDEKEKEFKLEVLEKTIAYVKELKEKVRLLEETPCRKCIEEDEDKDESVQDIEINLSSHSLTGRGEDYQYEKGVKPLKGSKYTVMEMCRGLAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.11
5 0.11
6 0.1
7 0.09
8 0.11
9 0.12
10 0.13
11 0.13
12 0.12
13 0.1
14 0.1
15 0.12
16 0.15
17 0.22
18 0.25
19 0.33
20 0.4
21 0.49
22 0.58
23 0.66
24 0.72
25 0.74
26 0.81
27 0.83
28 0.87
29 0.88
30 0.87
31 0.85
32 0.78
33 0.72
34 0.62
35 0.52
36 0.45
37 0.42
38 0.33
39 0.29
40 0.25
41 0.21
42 0.22
43 0.24
44 0.19
45 0.15
46 0.18
47 0.14
48 0.22
49 0.23
50 0.23
51 0.25
52 0.26
53 0.26
54 0.26
55 0.26
56 0.2
57 0.26
58 0.33
59 0.37
60 0.38
61 0.38
62 0.35
63 0.35
64 0.34
65 0.3
66 0.31
67 0.31
68 0.32
69 0.37
70 0.37
71 0.37
72 0.36
73 0.32
74 0.24
75 0.16
76 0.13
77 0.06
78 0.05
79 0.06
80 0.06
81 0.07
82 0.06
83 0.07
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.09
91 0.1
92 0.11
93 0.12
94 0.16
95 0.18
96 0.2
97 0.22
98 0.2
99 0.26
100 0.32
101 0.31
102 0.34
103 0.39
104 0.45
105 0.49
106 0.52
107 0.53
108 0.52
109 0.54
110 0.53
111 0.47
112 0.42
113 0.36