Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4LV58

Protein Details
Accession A0A4S4LV58    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-98EYKPERKERKEEYKKDEYKPERKERKEEYKKDEYKPBasic
NLS Segment(s)
PositionSequence
65-102KPERKERKEEYKKDEYKPERKERKEEYKKDEYKPXRKX
Subcellular Location(s) extr 6, E.R. 6, mito 5, golg 5, vacu 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001338  Hydrophobin  
IPR019778  Hydrophobin_CS  
Gene Ontology GO:0005576  C:extracellular region  
GO:0009277  C:fungal-type cell wall  
GO:0005199  F:structural constituent of cell wall  
Pfam View protein in Pfam  
PF01185  Hydrophobin  
PROSITE View protein in PROSITE  
PS00956  HYDROPHOBIN  
CDD cd23507  hydrophobin_I  
Amino Acid Sequences MYTRVLPALSVLAIATMAAASPATAGYGKSVDYKPSEYTPQYKRDDYKPEYKAERKEEYEKDEYKPERKERKEEYKKDEYKPERKERKEEYKKDEYKPXRKXENEHRDEYKPERKDDHHDEYKSERMDFRMDEYKNEKVKVKNQCNAGPVHCCDTIEDVHSESVSKALGLLGDGALALGNMEVPMGLNCSPVAGGSGANCAAQPACCDHVESGLGVNCSPVNLILGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.05
12 0.06
13 0.07
14 0.08
15 0.09
16 0.14
17 0.16
18 0.19
19 0.21
20 0.24
21 0.26
22 0.29
23 0.34
24 0.33
25 0.4
26 0.42
27 0.48
28 0.5
29 0.53
30 0.54
31 0.55
32 0.61
33 0.59
34 0.62
35 0.58
36 0.6
37 0.63
38 0.65
39 0.65
40 0.63
41 0.63
42 0.59
43 0.62
44 0.6
45 0.59
46 0.59
47 0.54
48 0.5
49 0.52
50 0.51
51 0.5
52 0.54
53 0.57
54 0.59
55 0.62
56 0.68
57 0.68
58 0.75
59 0.79
60 0.8
61 0.78
62 0.79
63 0.8
64 0.76
65 0.77
66 0.74
67 0.73
68 0.74
69 0.77
70 0.76
71 0.75
72 0.79
73 0.78
74 0.8
75 0.82
76 0.81
77 0.78
78 0.79
79 0.8
80 0.78
81 0.79
82 0.76
83 0.75
84 0.75
85 0.71
86 0.71
87 0.72
88 0.76
89 0.74
90 0.75
91 0.7
92 0.65
93 0.67
94 0.63
95 0.64
96 0.56
97 0.51
98 0.44
99 0.43
100 0.47
101 0.47
102 0.49
103 0.48
104 0.45
105 0.45
106 0.44
107 0.46
108 0.4
109 0.33
110 0.25
111 0.19
112 0.21
113 0.19
114 0.2
115 0.23
116 0.22
117 0.25
118 0.28
119 0.34
120 0.35
121 0.36
122 0.37
123 0.33
124 0.41
125 0.48
126 0.52
127 0.49
128 0.52
129 0.53
130 0.51
131 0.49
132 0.44
133 0.38
134 0.31
135 0.31
136 0.26
137 0.23
138 0.21
139 0.21
140 0.19
141 0.17
142 0.16
143 0.13
144 0.13
145 0.13
146 0.12
147 0.1
148 0.09
149 0.07
150 0.06
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.02
164 0.03
165 0.02
166 0.02
167 0.02
168 0.03
169 0.04
170 0.06
171 0.06
172 0.07
173 0.07
174 0.08
175 0.08
176 0.07
177 0.08
178 0.06
179 0.07
180 0.07
181 0.09
182 0.1
183 0.1
184 0.1
185 0.09
186 0.09
187 0.1
188 0.11
189 0.12
190 0.15
191 0.16
192 0.18
193 0.17
194 0.19
195 0.2
196 0.18
197 0.18
198 0.18
199 0.18
200 0.16
201 0.17
202 0.14
203 0.13
204 0.14
205 0.1