Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LF27

Protein Details
Accession A0A4S4LF27   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-55GNNVPFSKKKTRRTWLPNVQSKRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 11.5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MFASLPSLAQAALSAPFKRSQLGLFHGKMKQYGNNVPFSKKKTRRTWLPNVQSKRLFSETLGENVRVKVTTRALKTIKKYGGLDQYVMKTKTDLLGWEGMRLRILVREAQERKVNKASPPIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.17
4 0.18
5 0.19
6 0.19
7 0.19
8 0.2
9 0.25
10 0.31
11 0.31
12 0.36
13 0.37
14 0.37
15 0.36
16 0.34
17 0.33
18 0.31
19 0.37
20 0.34
21 0.4
22 0.4
23 0.42
24 0.45
25 0.47
26 0.52
27 0.53
28 0.6
29 0.61
30 0.68
31 0.74
32 0.78
33 0.83
34 0.82
35 0.83
36 0.83
37 0.78
38 0.75
39 0.68
40 0.6
41 0.54
42 0.46
43 0.36
44 0.27
45 0.27
46 0.22
47 0.22
48 0.22
49 0.19
50 0.17
51 0.17
52 0.17
53 0.12
54 0.12
55 0.12
56 0.16
57 0.2
58 0.21
59 0.28
60 0.31
61 0.36
62 0.39
63 0.44
64 0.42
65 0.4
66 0.4
67 0.39
68 0.43
69 0.39
70 0.36
71 0.31
72 0.32
73 0.34
74 0.33
75 0.28
76 0.21
77 0.2
78 0.21
79 0.19
80 0.16
81 0.13
82 0.18
83 0.18
84 0.22
85 0.23
86 0.22
87 0.21
88 0.2
89 0.18
90 0.15
91 0.17
92 0.17
93 0.19
94 0.28
95 0.31
96 0.37
97 0.44
98 0.43
99 0.48
100 0.52
101 0.53
102 0.47