Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LZK1

Protein Details
Accession A0A4S4LZK1   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
281-306NVPTKAPPGAGKKKKKRMAIPASAASHydrophilic
NLS Segment(s)
PositionSequence
287-299APPGAGKKKKKRM
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007018  Mediator_Med6  
IPR038566  Mediator_Med6_sf  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF04934  Med6  
Amino Acid Sequences MDLNDLHPPDDYSHRFFIWHEWIQANGPLTTENVFDYFASSMFYDKQSNNQVLRMQTMHTGMPILNEAEELKRFTGIEFALVHAQPPSLFIIHKRERISPEETRPLAAYFIMNNRIYQSPDMYTVLSNRLLTSLYSLQSSLDILRKYRPDYTPRTGFVWPVLEPSASDDTNKKHRPEDTVPSGDTEPELSELEKDGDKVASASEGAKKLQNNMLLFXAMRTTAAHASKLFQAQTQRAAAPENPMPETPTSSIAPRLSATPAPPPARAATPHVAPSTSGPQDNVPTKAPPGAGKKKKKRMAIPASAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.33
4 0.36
5 0.36
6 0.36
7 0.34
8 0.32
9 0.33
10 0.34
11 0.37
12 0.32
13 0.23
14 0.19
15 0.16
16 0.16
17 0.16
18 0.14
19 0.12
20 0.11
21 0.11
22 0.11
23 0.12
24 0.11
25 0.1
26 0.11
27 0.1
28 0.11
29 0.12
30 0.15
31 0.18
32 0.18
33 0.25
34 0.3
35 0.37
36 0.36
37 0.38
38 0.4
39 0.37
40 0.4
41 0.34
42 0.28
43 0.24
44 0.25
45 0.21
46 0.17
47 0.17
48 0.13
49 0.13
50 0.13
51 0.1
52 0.08
53 0.09
54 0.1
55 0.11
56 0.12
57 0.13
58 0.12
59 0.12
60 0.12
61 0.12
62 0.15
63 0.12
64 0.14
65 0.13
66 0.14
67 0.16
68 0.16
69 0.16
70 0.13
71 0.13
72 0.1
73 0.11
74 0.11
75 0.08
76 0.09
77 0.12
78 0.21
79 0.27
80 0.32
81 0.33
82 0.37
83 0.4
84 0.44
85 0.47
86 0.44
87 0.45
88 0.48
89 0.46
90 0.42
91 0.39
92 0.35
93 0.29
94 0.23
95 0.17
96 0.1
97 0.13
98 0.17
99 0.17
100 0.16
101 0.18
102 0.19
103 0.2
104 0.19
105 0.17
106 0.13
107 0.15
108 0.16
109 0.14
110 0.13
111 0.13
112 0.15
113 0.14
114 0.13
115 0.11
116 0.1
117 0.1
118 0.09
119 0.12
120 0.11
121 0.11
122 0.11
123 0.11
124 0.1
125 0.1
126 0.11
127 0.09
128 0.1
129 0.1
130 0.11
131 0.15
132 0.17
133 0.19
134 0.24
135 0.26
136 0.29
137 0.36
138 0.41
139 0.42
140 0.42
141 0.43
142 0.38
143 0.34
144 0.29
145 0.24
146 0.18
147 0.15
148 0.13
149 0.1
150 0.1
151 0.13
152 0.14
153 0.12
154 0.13
155 0.14
156 0.17
157 0.27
158 0.32
159 0.3
160 0.31
161 0.33
162 0.39
163 0.43
164 0.47
165 0.45
166 0.43
167 0.42
168 0.4
169 0.38
170 0.31
171 0.25
172 0.18
173 0.11
174 0.09
175 0.09
176 0.07
177 0.07
178 0.08
179 0.09
180 0.09
181 0.09
182 0.08
183 0.08
184 0.08
185 0.08
186 0.07
187 0.06
188 0.06
189 0.07
190 0.11
191 0.12
192 0.13
193 0.16
194 0.17
195 0.2
196 0.23
197 0.27
198 0.23
199 0.24
200 0.24
201 0.22
202 0.21
203 0.18
204 0.15
205 0.1
206 0.09
207 0.09
208 0.12
209 0.12
210 0.14
211 0.14
212 0.15
213 0.18
214 0.21
215 0.2
216 0.18
217 0.23
218 0.23
219 0.28
220 0.28
221 0.25
222 0.23
223 0.26
224 0.24
225 0.24
226 0.24
227 0.22
228 0.22
229 0.22
230 0.24
231 0.22
232 0.25
233 0.21
234 0.22
235 0.2
236 0.2
237 0.25
238 0.23
239 0.23
240 0.2
241 0.2
242 0.2
243 0.21
244 0.22
245 0.24
246 0.31
247 0.33
248 0.33
249 0.33
250 0.32
251 0.34
252 0.34
253 0.34
254 0.31
255 0.31
256 0.35
257 0.34
258 0.31
259 0.29
260 0.3
261 0.31
262 0.3
263 0.28
264 0.25
265 0.26
266 0.33
267 0.37
268 0.36
269 0.31
270 0.3
271 0.3
272 0.32
273 0.32
274 0.31
275 0.37
276 0.45
277 0.53
278 0.62
279 0.71
280 0.79
281 0.85
282 0.88
283 0.87
284 0.87
285 0.88
286 0.87