Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LTC5

Protein Details
Accession A0A4S4LTC5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-106KPEYKAERKEYKEYKPKRKDEYEPERKEERKDEYKPKRKEEYKKEQYKRDEYKSBasic
NLS Segment(s)
PositionSequence
61-99KXEYXKXEYKPKRKDEYEPERKEERKDEYKPKRKEEYKK
Subcellular Location(s) E.R. 9, extr 6, golg 4, mito 3, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004789  Acetalactate_synth_ssu  
IPR045865  ACT-like_dom_sf  
IPR039557  AHAS_ACT  
IPR001338  Hydrophobin  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0009277  C:fungal-type cell wall  
GO:1990610  F:acetolactate synthase regulator activity  
GO:0005199  F:structural constituent of cell wall  
GO:0009082  P:branched-chain amino acid biosynthetic process  
Pfam View protein in Pfam  
PF01185  Hydrophobin  
CDD cd04878  ACT_AHAS  
cd23507  hydrophobin_I  
Amino Acid Sequences MYTRVLPALSVLAIATMAAASPATAGYGKSVDYKPSEYRPSEYTPQYKRDDYKPEYKAERKXEYXKXEYKPKRKDEYEPERKEERKDEYKPKRKEEYKKEQYKRDEYKSDRVDFRMDEYKNEKVKNQCNTGPVHCCDTIEDASSENVSKYSGLLGDALSVQGANVPVGLNCSPAAGGSGANCAAQPACCDHVESSERRAILTARRLQKANWDNSETKLGSLQISAAVLSRVSEILARCGFNIDSLVICRTKIHDLIRMSIVLGGQNGVVEQARRQLGDLVPVWAMLDHTEARTIVRELLLVKVSIINPEYLEEQVLADLRTSRVVAAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.05
11 0.06
12 0.06
13 0.08
14 0.09
15 0.1
16 0.16
17 0.17
18 0.2
19 0.23
20 0.28
21 0.32
22 0.39
23 0.45
24 0.42
25 0.45
26 0.45
27 0.49
28 0.51
29 0.53
30 0.55
31 0.53
32 0.58
33 0.6
34 0.62
35 0.6
36 0.6
37 0.63
38 0.6
39 0.64
40 0.61
41 0.63
42 0.66
43 0.68
44 0.68
45 0.68
46 0.71
47 0.67
48 0.73
49 0.73
50 0.74
51 0.78
52 0.8
53 0.81
54 0.82
55 0.85
56 0.84
57 0.84
58 0.83
59 0.83
60 0.84
61 0.84
62 0.8
63 0.78
64 0.77
65 0.72
66 0.68
67 0.63
68 0.6
69 0.59
70 0.61
71 0.66
72 0.69
73 0.76
74 0.79
75 0.81
76 0.83
77 0.83
78 0.85
79 0.85
80 0.85
81 0.85
82 0.88
83 0.87
84 0.85
85 0.85
86 0.84
87 0.82
88 0.78
89 0.76
90 0.71
91 0.73
92 0.71
93 0.68
94 0.61
95 0.54
96 0.49
97 0.41
98 0.4
99 0.38
100 0.31
101 0.3
102 0.31
103 0.37
104 0.39
105 0.4
106 0.4
107 0.4
108 0.47
109 0.49
110 0.5
111 0.45
112 0.44
113 0.46
114 0.46
115 0.43
116 0.37
117 0.35
118 0.29
119 0.26
120 0.24
121 0.24
122 0.2
123 0.16
124 0.15
125 0.11
126 0.12
127 0.12
128 0.11
129 0.08
130 0.07
131 0.06
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.03
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.05
160 0.05
161 0.04
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.05
168 0.05
169 0.06
170 0.07
171 0.09
172 0.09
173 0.1
174 0.1
175 0.15
176 0.18
177 0.19
178 0.2
179 0.2
180 0.2
181 0.19
182 0.2
183 0.17
184 0.2
185 0.26
186 0.3
187 0.34
188 0.37
189 0.38
190 0.37
191 0.45
192 0.48
193 0.47
194 0.44
195 0.43
196 0.41
197 0.42
198 0.48
199 0.38
200 0.3
201 0.25
202 0.21
203 0.16
204 0.15
205 0.13
206 0.08
207 0.08
208 0.07
209 0.06
210 0.06
211 0.05
212 0.06
213 0.06
214 0.05
215 0.05
216 0.08
217 0.08
218 0.13
219 0.15
220 0.15
221 0.14
222 0.16
223 0.16
224 0.14
225 0.14
226 0.1
227 0.09
228 0.1
229 0.12
230 0.11
231 0.11
232 0.12
233 0.13
234 0.17
235 0.21
236 0.22
237 0.27
238 0.28
239 0.31
240 0.32
241 0.3
242 0.26
243 0.23
244 0.2
245 0.14
246 0.13
247 0.09
248 0.07
249 0.07
250 0.07
251 0.06
252 0.07
253 0.07
254 0.07
255 0.13
256 0.15
257 0.15
258 0.16
259 0.2
260 0.19
261 0.25
262 0.25
263 0.21
264 0.19
265 0.19
266 0.18
267 0.14
268 0.13
269 0.08
270 0.1
271 0.09
272 0.1
273 0.12
274 0.12
275 0.13
276 0.15
277 0.16
278 0.15
279 0.14
280 0.15
281 0.14
282 0.18
283 0.19
284 0.16
285 0.15
286 0.17
287 0.17
288 0.2
289 0.2
290 0.17
291 0.16
292 0.18
293 0.19
294 0.15
295 0.16
296 0.12
297 0.12
298 0.12
299 0.13
300 0.12
301 0.11
302 0.13
303 0.13
304 0.14
305 0.15