Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4M1R0

Protein Details
Accession A0A4S4M1R0   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-106DATTKFRKLLSKEKNPPIEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR002652  Importin-a_IBB  
IPR036975  Importin-a_IBB_sf  
Gene Ontology GO:0061608  F:nuclear import signal receptor activity  
GO:0006606  P:protein import into nucleus  
Pfam View protein in Pfam  
PF01749  IBB  
PROSITE View protein in PROSITE  
PS51214  IBB  
Amino Acid Sequences MDRSSANRREQYKNKALKQDDLRRRREEQQVEIRRQKREENIAKRRNFAPSVGVDSDEETASSSWDPPLAEEMISGVFSDDLERQLDATTKFRKLLSKEKNPPIEKSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.74
4 0.73
5 0.75
6 0.75
7 0.76
8 0.75
9 0.75
10 0.71
11 0.73
12 0.71
13 0.7
14 0.65
15 0.64
16 0.65
17 0.67
18 0.7
19 0.74
20 0.72
21 0.67
22 0.64
23 0.6
24 0.55
25 0.57
26 0.58
27 0.59
28 0.65
29 0.69
30 0.69
31 0.67
32 0.62
33 0.56
34 0.47
35 0.37
36 0.29
37 0.22
38 0.25
39 0.22
40 0.21
41 0.16
42 0.16
43 0.16
44 0.12
45 0.11
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.06
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.07
63 0.05
64 0.04
65 0.05
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.1
73 0.13
74 0.14
75 0.2
76 0.24
77 0.26
78 0.28
79 0.3
80 0.36
81 0.39
82 0.47
83 0.51
84 0.58
85 0.65
86 0.73
87 0.81
88 0.78