Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FKH1

Protein Details
Accession C5FKH1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-139PSPANNRRTKKLKTECKKEIKKEIKSEENPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, mito 11
Family & Domain DBs
Amino Acid Sequences MPVIWNDAARAKLLMAIVKTSGGKIDYKGIVEFMGPEYNAKCIQNQIQFIKNKANGDKAPGSTPSTPTKGEKKGNSAAGSVKTPTKSPASAKRGHEQAVGPESETTINTPSPANNRRTKKLKTECKKEIKKEIKSEENPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.15
4 0.14
5 0.16
6 0.16
7 0.14
8 0.14
9 0.13
10 0.13
11 0.13
12 0.18
13 0.18
14 0.19
15 0.19
16 0.18
17 0.16
18 0.15
19 0.15
20 0.11
21 0.11
22 0.1
23 0.11
24 0.11
25 0.13
26 0.15
27 0.15
28 0.14
29 0.15
30 0.21
31 0.25
32 0.29
33 0.3
34 0.35
35 0.37
36 0.38
37 0.42
38 0.39
39 0.37
40 0.34
41 0.36
42 0.3
43 0.33
44 0.34
45 0.28
46 0.27
47 0.25
48 0.27
49 0.22
50 0.25
51 0.23
52 0.23
53 0.23
54 0.25
55 0.29
56 0.32
57 0.36
58 0.35
59 0.37
60 0.39
61 0.42
62 0.39
63 0.34
64 0.3
65 0.26
66 0.25
67 0.21
68 0.19
69 0.16
70 0.15
71 0.17
72 0.17
73 0.18
74 0.23
75 0.31
76 0.35
77 0.42
78 0.45
79 0.48
80 0.49
81 0.48
82 0.45
83 0.36
84 0.34
85 0.31
86 0.27
87 0.22
88 0.19
89 0.18
90 0.16
91 0.15
92 0.12
93 0.1
94 0.1
95 0.11
96 0.11
97 0.14
98 0.22
99 0.29
100 0.35
101 0.42
102 0.49
103 0.57
104 0.65
105 0.69
106 0.7
107 0.74
108 0.78
109 0.8
110 0.84
111 0.85
112 0.88
113 0.91
114 0.89
115 0.9
116 0.89
117 0.87
118 0.87
119 0.85
120 0.85