Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FFJ5

Protein Details
Accession C5FFJ5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-106VYYIDNKRPRLKEKKKPYLRKSDKTPFSLNHydrophilic
NLS Segment(s)
PositionSequence
83-97KRPRLKEKKKPYLRK
Subcellular Location(s) plas 9, E.R. 6, mito 5, golg 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVTLVCVPEFCCLVQRTQREGFVVFLIQGVFCFLIDLLLSLKLAFLVAMGDGRHQPLNNRHTVIYIVRRRHAGEMMVYYIDNKRPRLKEKKKPYLRKSDKTPFSLNSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.39
4 0.41
5 0.43
6 0.39
7 0.39
8 0.34
9 0.27
10 0.23
11 0.16
12 0.13
13 0.11
14 0.09
15 0.08
16 0.07
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.05
38 0.05
39 0.07
40 0.08
41 0.08
42 0.12
43 0.18
44 0.23
45 0.25
46 0.26
47 0.25
48 0.25
49 0.27
50 0.26
51 0.28
52 0.3
53 0.31
54 0.31
55 0.33
56 0.34
57 0.34
58 0.32
59 0.25
60 0.2
61 0.19
62 0.18
63 0.17
64 0.15
65 0.15
66 0.15
67 0.2
68 0.22
69 0.24
70 0.31
71 0.36
72 0.46
73 0.56
74 0.65
75 0.7
76 0.77
77 0.85
78 0.88
79 0.93
80 0.93
81 0.93
82 0.93
83 0.91
84 0.9
85 0.89
86 0.87
87 0.82
88 0.78