Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3XCM2

Protein Details
Accession A0A4V3XCM2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
214-252AEVVKRTKTQKAKPTKVGTKRSKRAPKSMKTKAAENKENHydrophilic
NLS Segment(s)
PositionSequence
218-247KRTKTQKAKPTKVGTKRSKRAPKSMKTKAA
Subcellular Location(s) cyto 16, cyto_nucl 11, nucl 4, mito 4
Family & Domain DBs
Amino Acid Sequences MAHVAPIAAPLVTADTFFTLPSSDSASVNSTTSTVDPALQAVTDATATVSIPAFEPVITPSSISPTPPIMHSPPLTHLLILKPPSGLTSRWLLEAMQCPRLPPTDPTTSSAVVAQHNAAPITTPTVPAITAPPVRAPESIQNDVMPSVRSAQPPLPATTSLSLAGHITRNEGPEIQPSLEAAGLDLGSVHLETSGEDRALRKRWNDSSGLDEGAEVVKRTKTQKAKPTKVGTKRSKRAPKSMKTKAAENKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.1
4 0.11
5 0.11
6 0.09
7 0.1
8 0.11
9 0.15
10 0.15
11 0.15
12 0.16
13 0.19
14 0.19
15 0.19
16 0.18
17 0.13
18 0.13
19 0.13
20 0.14
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.09
27 0.09
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.1
45 0.1
46 0.1
47 0.09
48 0.14
49 0.14
50 0.14
51 0.15
52 0.15
53 0.16
54 0.17
55 0.21
56 0.19
57 0.23
58 0.23
59 0.23
60 0.23
61 0.27
62 0.25
63 0.21
64 0.21
65 0.18
66 0.21
67 0.21
68 0.19
69 0.15
70 0.15
71 0.16
72 0.17
73 0.15
74 0.13
75 0.16
76 0.16
77 0.16
78 0.16
79 0.15
80 0.16
81 0.22
82 0.23
83 0.23
84 0.23
85 0.22
86 0.23
87 0.25
88 0.24
89 0.19
90 0.22
91 0.24
92 0.26
93 0.28
94 0.3
95 0.29
96 0.27
97 0.26
98 0.22
99 0.15
100 0.14
101 0.12
102 0.1
103 0.1
104 0.1
105 0.08
106 0.07
107 0.06
108 0.09
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.09
116 0.09
117 0.1
118 0.1
119 0.11
120 0.12
121 0.14
122 0.14
123 0.15
124 0.19
125 0.23
126 0.25
127 0.24
128 0.22
129 0.21
130 0.22
131 0.21
132 0.14
133 0.08
134 0.1
135 0.12
136 0.13
137 0.14
138 0.16
139 0.2
140 0.22
141 0.23
142 0.22
143 0.2
144 0.21
145 0.19
146 0.19
147 0.15
148 0.13
149 0.11
150 0.1
151 0.11
152 0.11
153 0.1
154 0.12
155 0.13
156 0.14
157 0.15
158 0.15
159 0.15
160 0.17
161 0.19
162 0.16
163 0.15
164 0.14
165 0.14
166 0.13
167 0.12
168 0.08
169 0.06
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.03
178 0.04
179 0.04
180 0.07
181 0.08
182 0.08
183 0.09
184 0.12
185 0.18
186 0.24
187 0.28
188 0.3
189 0.37
190 0.43
191 0.46
192 0.48
193 0.44
194 0.44
195 0.41
196 0.38
197 0.3
198 0.24
199 0.2
200 0.18
201 0.17
202 0.12
203 0.11
204 0.12
205 0.16
206 0.21
207 0.29
208 0.37
209 0.45
210 0.55
211 0.64
212 0.72
213 0.78
214 0.84
215 0.85
216 0.86
217 0.87
218 0.88
219 0.88
220 0.88
221 0.89
222 0.9
223 0.87
224 0.88
225 0.88
226 0.87
227 0.87
228 0.88
229 0.87
230 0.8
231 0.82
232 0.81