Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LCX5

Protein Details
Accession A0A4S4LCX5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
236-264HPTHAPPPRSPLRRPRPRRRTAAGPRGTSBasic
NLS Segment(s)
PositionSequence
258-294RRHFLRRARPHPTHAPPPRXSPLRXRPRPRXRXRXTX
Subcellular Location(s) mito 14.5, cyto_mito 9, extr 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012981  PIH1_N  
Pfam View protein in Pfam  
PF08190  PIH1  
Amino Acid Sequences MPGFKQTIFSLRAGHLPRTIAAGKAALVFDCIFNSSLKSRTLKDPAFKTFLTELALQRIEAQSSLLLSRSLGSPNIASKGPLQPRTATVPAALFPPSHPLHHSPASTSPSPKKLIEELSAPTPTSAPAPRKGILKNSTGAENSAKHTARHVPGALXAPSWTWALDAAHIRFTIXVPKLVSPFSYSTSMSCLHXRRTSPCCXHLICSXSXXXKTXXRIXNIXHAEHXXPTXXXXXXYNXXXXSXXXXXXXXLTVPTDPRRHFLRRARPHPTHAPPPRXSPLRXRPRPRXRXRXTXAAGPRGTSTSTAXAQNGASXTARSFSSXXSGSVAXNCXHQQXQKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.31
4 0.3
5 0.32
6 0.31
7 0.25
8 0.22
9 0.2
10 0.18
11 0.18
12 0.18
13 0.12
14 0.13
15 0.13
16 0.12
17 0.12
18 0.13
19 0.11
20 0.11
21 0.14
22 0.15
23 0.18
24 0.22
25 0.25
26 0.27
27 0.33
28 0.42
29 0.45
30 0.5
31 0.53
32 0.54
33 0.56
34 0.52
35 0.49
36 0.42
37 0.37
38 0.33
39 0.3
40 0.25
41 0.26
42 0.26
43 0.21
44 0.22
45 0.21
46 0.19
47 0.15
48 0.15
49 0.09
50 0.1
51 0.1
52 0.09
53 0.08
54 0.08
55 0.09
56 0.09
57 0.1
58 0.1
59 0.11
60 0.11
61 0.13
62 0.16
63 0.15
64 0.14
65 0.16
66 0.24
67 0.29
68 0.32
69 0.33
70 0.32
71 0.34
72 0.4
73 0.38
74 0.3
75 0.25
76 0.21
77 0.19
78 0.19
79 0.17
80 0.11
81 0.09
82 0.16
83 0.16
84 0.16
85 0.18
86 0.2
87 0.25
88 0.28
89 0.28
90 0.24
91 0.28
92 0.32
93 0.31
94 0.32
95 0.32
96 0.32
97 0.35
98 0.34
99 0.31
100 0.29
101 0.31
102 0.28
103 0.26
104 0.23
105 0.23
106 0.23
107 0.2
108 0.17
109 0.14
110 0.13
111 0.13
112 0.15
113 0.15
114 0.19
115 0.22
116 0.24
117 0.28
118 0.29
119 0.34
120 0.34
121 0.33
122 0.31
123 0.28
124 0.28
125 0.25
126 0.25
127 0.19
128 0.17
129 0.16
130 0.19
131 0.19
132 0.17
133 0.19
134 0.23
135 0.22
136 0.23
137 0.21
138 0.16
139 0.17
140 0.19
141 0.18
142 0.13
143 0.12
144 0.11
145 0.11
146 0.1
147 0.08
148 0.07
149 0.06
150 0.08
151 0.11
152 0.1
153 0.12
154 0.11
155 0.12
156 0.12
157 0.13
158 0.14
159 0.12
160 0.12
161 0.11
162 0.14
163 0.14
164 0.14
165 0.15
166 0.14
167 0.15
168 0.17
169 0.17
170 0.15
171 0.17
172 0.18
173 0.18
174 0.22
175 0.21
176 0.21
177 0.27
178 0.31
179 0.34
180 0.41
181 0.45
182 0.47
183 0.45
184 0.46
185 0.43
186 0.45
187 0.44
188 0.41
189 0.41
190 0.39
191 0.43
192 0.42
193 0.44
194 0.44
195 0.42
196 0.41
197 0.44
198 0.41
199 0.38
200 0.37
201 0.34
202 0.29
203 0.26
204 0.22
205 0.14
206 0.14
207 0.15
208 0.2
209 0.24
210 0.32
211 0.33
212 0.36
213 0.42
214 0.46
215 0.53
216 0.56
217 0.61
218 0.63
219 0.71
220 0.77
221 0.76
222 0.78
223 0.78
224 0.76
225 0.76
226 0.74
227 0.74
228 0.67
229 0.7
230 0.73
231 0.69
232 0.69
233 0.7
234 0.71
235 0.74
236 0.82
237 0.85
238 0.87
239 0.9
240 0.91
241 0.87
242 0.87
243 0.87
244 0.87
245 0.84
246 0.77
247 0.7
248 0.65
249 0.58
250 0.49
251 0.41
252 0.36
253 0.3
254 0.28
255 0.26
256 0.22
257 0.21
258 0.21
259 0.19
260 0.15
261 0.12
262 0.12
263 0.13
264 0.15
265 0.15
266 0.14
267 0.18
268 0.17
269 0.19
270 0.19
271 0.21
272 0.21
273 0.29
274 0.34