Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LHV8

Protein Details
Accession A0A4S4LHV8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-57MAARRLKLKRKLLLYPQPRKRKRLLHLLEHRPSTNQSSRKGEKAWRRKKNIDDVEGHHydrophilic
NLS Segment(s)
PositionSequence
4-49RRLKLKRKLLLYPQPRKRKRLLHLLEHRPSTNQSSRKGEKAWRRKK
Subcellular Location(s) plas 24, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005828  MFS_sugar_transport-like  
IPR036259  MFS_trans_sf  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0016020  C:membrane  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0022857  F:transmembrane transporter activity  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF07767  Nop53  
PF00083  Sugar_tr  
Amino Acid Sequences MAARRLKLKRKLLLYPQPRKRKRLLHLLEHRPSTNQSSRKGEKAWRRKKNIDDVEGHLEGIRDEERMFGKALREKKNEEFFMNDTKGDETRLSIASLVLPRLTLSPYNRQIPPQILSHLSFLTLKPFATFRRPRRLFTPIINIRQAKVLAHALGERPMTVNWQKGKEGSSQQFPLMEVSEAVRKVGSMMFKRHWLLCIYAVLLMTGFNFLPHGSQDLYPTCLALTKGFDNYHSTVATIIGNCGAIAGGVIAGWLSQYLGRRLTIVSFVLLIGAFIPLWIIPNSFGGLSAGAFWVEFGVQGAWGVIPIQLAEMSPRAFCATFPGAAYQLGNMPVGQRRNRTTGPSSVLKTTVRMCLMPGNGARGNKSTCRKPISSLLNEVCFSPAPTSREAPQSIRGLQQSVNNEMDGFAPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.87
5 0.88
6 0.86
7 0.85
8 0.84
9 0.82
10 0.82
11 0.81
12 0.8
13 0.83
14 0.86
15 0.84
16 0.79
17 0.71
18 0.63
19 0.58
20 0.55
21 0.54
22 0.49
23 0.49
24 0.54
25 0.58
26 0.61
27 0.63
28 0.64
29 0.66
30 0.71
31 0.74
32 0.75
33 0.8
34 0.83
35 0.86
36 0.88
37 0.86
38 0.82
39 0.76
40 0.71
41 0.69
42 0.61
43 0.52
44 0.41
45 0.32
46 0.24
47 0.22
48 0.16
49 0.1
50 0.09
51 0.13
52 0.13
53 0.15
54 0.16
55 0.16
56 0.21
57 0.27
58 0.36
59 0.42
60 0.46
61 0.5
62 0.58
63 0.64
64 0.62
65 0.57
66 0.53
67 0.46
68 0.49
69 0.45
70 0.37
71 0.29
72 0.28
73 0.26
74 0.24
75 0.21
76 0.14
77 0.16
78 0.16
79 0.15
80 0.13
81 0.13
82 0.15
83 0.16
84 0.15
85 0.12
86 0.11
87 0.11
88 0.12
89 0.14
90 0.15
91 0.17
92 0.26
93 0.32
94 0.37
95 0.38
96 0.39
97 0.41
98 0.4
99 0.39
100 0.32
101 0.29
102 0.27
103 0.27
104 0.27
105 0.23
106 0.2
107 0.18
108 0.16
109 0.17
110 0.15
111 0.13
112 0.13
113 0.15
114 0.16
115 0.25
116 0.34
117 0.38
118 0.49
119 0.52
120 0.54
121 0.57
122 0.61
123 0.54
124 0.5
125 0.54
126 0.5
127 0.52
128 0.55
129 0.5
130 0.44
131 0.43
132 0.38
133 0.28
134 0.23
135 0.2
136 0.14
137 0.14
138 0.14
139 0.12
140 0.14
141 0.14
142 0.11
143 0.1
144 0.1
145 0.14
146 0.15
147 0.2
148 0.22
149 0.24
150 0.25
151 0.25
152 0.28
153 0.28
154 0.33
155 0.31
156 0.32
157 0.3
158 0.3
159 0.29
160 0.27
161 0.23
162 0.16
163 0.13
164 0.09
165 0.08
166 0.11
167 0.1
168 0.1
169 0.09
170 0.08
171 0.08
172 0.1
173 0.14
174 0.14
175 0.18
176 0.2
177 0.23
178 0.25
179 0.25
180 0.24
181 0.21
182 0.19
183 0.16
184 0.15
185 0.12
186 0.12
187 0.11
188 0.09
189 0.08
190 0.06
191 0.05
192 0.05
193 0.05
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.06
200 0.07
201 0.07
202 0.1
203 0.1
204 0.12
205 0.12
206 0.12
207 0.1
208 0.1
209 0.1
210 0.09
211 0.1
212 0.09
213 0.12
214 0.13
215 0.14
216 0.17
217 0.18
218 0.18
219 0.16
220 0.15
221 0.13
222 0.13
223 0.13
224 0.09
225 0.08
226 0.06
227 0.06
228 0.06
229 0.06
230 0.04
231 0.03
232 0.03
233 0.03
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.04
243 0.06
244 0.08
245 0.1
246 0.1
247 0.11
248 0.11
249 0.12
250 0.12
251 0.11
252 0.1
253 0.09
254 0.08
255 0.08
256 0.07
257 0.06
258 0.05
259 0.04
260 0.04
261 0.03
262 0.04
263 0.03
264 0.05
265 0.05
266 0.06
267 0.06
268 0.07
269 0.08
270 0.08
271 0.08
272 0.07
273 0.07
274 0.06
275 0.06
276 0.06
277 0.05
278 0.05
279 0.05
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.05
288 0.04
289 0.04
290 0.05
291 0.04
292 0.04
293 0.04
294 0.05
295 0.05
296 0.05
297 0.06
298 0.08
299 0.08
300 0.08
301 0.09
302 0.11
303 0.11
304 0.11
305 0.16
306 0.17
307 0.17
308 0.18
309 0.19
310 0.18
311 0.18
312 0.18
313 0.12
314 0.12
315 0.12
316 0.12
317 0.1
318 0.12
319 0.16
320 0.23
321 0.27
322 0.31
323 0.35
324 0.42
325 0.44
326 0.49
327 0.48
328 0.48
329 0.5
330 0.49
331 0.48
332 0.43
333 0.44
334 0.39
335 0.37
336 0.33
337 0.33
338 0.28
339 0.26
340 0.24
341 0.26
342 0.27
343 0.29
344 0.27
345 0.28
346 0.3
347 0.31
348 0.32
349 0.31
350 0.34
351 0.37
352 0.43
353 0.45
354 0.5
355 0.56
356 0.56
357 0.57
358 0.62
359 0.63
360 0.61
361 0.62
362 0.59
363 0.56
364 0.54
365 0.49
366 0.42
367 0.33
368 0.28
369 0.23
370 0.24
371 0.23
372 0.27
373 0.29
374 0.31
375 0.38
376 0.41
377 0.4
378 0.42
379 0.45
380 0.43
381 0.46
382 0.44
383 0.4
384 0.38
385 0.41
386 0.38
387 0.38
388 0.37
389 0.31
390 0.29
391 0.27