Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4M0Q3

Protein Details
Accession A0A4S4M0Q3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
280-301GKDTTKKAVAKKVKKGGKVKAABasic
NLS Segment(s)
PositionSequence
285-301KKAVAKKVKKGGKVKAA
Subcellular Location(s) extr 14, plas 8, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009580  GPI_biosynthesis_protein_Pig-F  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06699  PIG-F  
Amino Acid Sequences MSASSSLTLPKQYPPLLLLHTLLLPASLFLLPQTSLVITLPAPERGLDKPQHPLLDPLTARPIVTVAWSVVGAAALVGWWAGWVREWVREGRMGGAGVETRLSRIGDKKATDVWNAWIFTLYASFAIHAVLVLFGAPITTHLMHTYLLSLLLSILTTFVPAYALGPPSLPLPLLSRNAGYAPDSSAGLIQNNTWIRLFAEFAPRTPSERALVYPAIGAFMGAWTGAIPIGLDWDRPWQAWPLTPAYSAVIGYVLGAIGALGTSGVLILAHMDTKSSAIDGKDTTKKAVAKKVKKGGKVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.31
5 0.27
6 0.22
7 0.21
8 0.19
9 0.17
10 0.13
11 0.1
12 0.08
13 0.08
14 0.07
15 0.06
16 0.06
17 0.08
18 0.08
19 0.09
20 0.1
21 0.08
22 0.09
23 0.09
24 0.1
25 0.08
26 0.12
27 0.13
28 0.14
29 0.14
30 0.14
31 0.16
32 0.18
33 0.25
34 0.25
35 0.26
36 0.32
37 0.35
38 0.37
39 0.36
40 0.37
41 0.32
42 0.36
43 0.34
44 0.29
45 0.3
46 0.27
47 0.26
48 0.23
49 0.21
50 0.13
51 0.14
52 0.12
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.05
60 0.04
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.04
70 0.06
71 0.08
72 0.11
73 0.13
74 0.15
75 0.17
76 0.19
77 0.19
78 0.19
79 0.19
80 0.16
81 0.14
82 0.13
83 0.12
84 0.09
85 0.1
86 0.08
87 0.07
88 0.08
89 0.09
90 0.1
91 0.14
92 0.19
93 0.22
94 0.23
95 0.25
96 0.29
97 0.31
98 0.3
99 0.27
100 0.26
101 0.26
102 0.25
103 0.23
104 0.18
105 0.16
106 0.15
107 0.14
108 0.1
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.03
125 0.05
126 0.06
127 0.06
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.06
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.04
147 0.04
148 0.04
149 0.05
150 0.06
151 0.06
152 0.06
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.07
159 0.11
160 0.12
161 0.13
162 0.13
163 0.13
164 0.14
165 0.14
166 0.12
167 0.1
168 0.09
169 0.09
170 0.09
171 0.09
172 0.09
173 0.09
174 0.09
175 0.08
176 0.07
177 0.12
178 0.13
179 0.14
180 0.13
181 0.13
182 0.13
183 0.13
184 0.15
185 0.11
186 0.2
187 0.19
188 0.2
189 0.25
190 0.25
191 0.27
192 0.27
193 0.27
194 0.2
195 0.21
196 0.21
197 0.2
198 0.2
199 0.17
200 0.16
201 0.14
202 0.12
203 0.11
204 0.1
205 0.05
206 0.05
207 0.05
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.07
217 0.07
218 0.07
219 0.08
220 0.13
221 0.15
222 0.15
223 0.17
224 0.18
225 0.19
226 0.22
227 0.25
228 0.24
229 0.24
230 0.24
231 0.24
232 0.21
233 0.2
234 0.16
235 0.13
236 0.09
237 0.08
238 0.07
239 0.06
240 0.05
241 0.04
242 0.03
243 0.03
244 0.02
245 0.02
246 0.02
247 0.02
248 0.02
249 0.02
250 0.02
251 0.02
252 0.02
253 0.02
254 0.04
255 0.04
256 0.06
257 0.06
258 0.07
259 0.07
260 0.08
261 0.09
262 0.08
263 0.11
264 0.1
265 0.14
266 0.16
267 0.23
268 0.3
269 0.31
270 0.33
271 0.37
272 0.41
273 0.45
274 0.54
275 0.57
276 0.6
277 0.68
278 0.76
279 0.77
280 0.81
281 0.84