Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4M6Y4

Protein Details
Accession A0A4S4M6Y4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-122ALGIHSTPRKDRKRAREYDHSHTSTHydrophilic
NLS Segment(s)
PositionSequence
105-111PRKDRKR
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MPTRLVYAPTDLQKLHTSHTHLTTCLSSELATTTTIIMKLRTIVAISSARKIAIAWQEDIAALANPDTSYEGRRHAEQELHQMGRSAHVPITTKIKRALGIHSTPRKDRKRAREYDHSHTSTTSRRRGFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.3
4 0.32
5 0.33
6 0.39
7 0.37
8 0.32
9 0.33
10 0.3
11 0.27
12 0.23
13 0.19
14 0.13
15 0.11
16 0.12
17 0.1
18 0.1
19 0.09
20 0.08
21 0.09
22 0.1
23 0.1
24 0.09
25 0.09
26 0.1
27 0.1
28 0.09
29 0.09
30 0.07
31 0.11
32 0.15
33 0.16
34 0.16
35 0.16
36 0.16
37 0.15
38 0.15
39 0.16
40 0.17
41 0.18
42 0.17
43 0.16
44 0.17
45 0.16
46 0.17
47 0.13
48 0.07
49 0.05
50 0.04
51 0.04
52 0.03
53 0.04
54 0.05
55 0.05
56 0.07
57 0.08
58 0.12
59 0.14
60 0.15
61 0.16
62 0.17
63 0.2
64 0.2
65 0.28
66 0.29
67 0.28
68 0.27
69 0.27
70 0.25
71 0.23
72 0.22
73 0.15
74 0.11
75 0.13
76 0.15
77 0.15
78 0.25
79 0.25
80 0.27
81 0.29
82 0.3
83 0.31
84 0.31
85 0.35
86 0.32
87 0.37
88 0.43
89 0.49
90 0.52
91 0.56
92 0.64
93 0.66
94 0.69
95 0.73
96 0.74
97 0.77
98 0.81
99 0.83
100 0.84
101 0.83
102 0.82
103 0.82
104 0.74
105 0.65
106 0.57
107 0.52
108 0.5
109 0.52
110 0.51