Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LWE3

Protein Details
Accession A0A4S4LWE3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-125MSEAALKKRHEREERRRKAEEBasic
285-311PAPDGDRRPRASRHRHEKKRICCVAGIBasic
NLS Segment(s)
PositionSequence
111-122KKRHEREERRRK
279-311ALRRDRPARARRAPAPDGDRRPRASRHRHEKKR
Subcellular Location(s) nucl 6mito 6mito_nucl 6, plas 5, cyto_nucl 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011856  tRNA_endonuc-like_dom_sf  
IPR036167  tRNA_intron_Endo_cat-like_sf  
IPR006677  tRNA_intron_Endonuc_cat-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0000213  F:tRNA-intron endonuclease activity  
GO:0006388  P:tRNA splicing, via endonucleolytic cleavage and ligation  
Pfam View protein in Pfam  
PF01974  tRNA_int_endo  
CDD cd22363  tRNA-intron_lyase_C  
Amino Acid Sequences MASSSSSFRVPIHVSNNRAFVWHADPQTSRPSAPTTTSAASSAGRCPHLSQQNVFLGLPLILMPEEVFLLMQKQLAVLVDDPSAHHTPTPAQLEKWNAERTQDAMSEAALKKRHEREERRRKAEEIARQAANGLPTDTVPSVPDTSXPSAPQTQAPSSSSPALPYTVTVPTTSDDMAWYAPAEHTFTSLDAARAAGXWNYPSTDDERAKCEVFRDLWEKGYFMGGGSKFGGDWLVYPGASLLLPFSXXXIXXFIQSTWYRSKYGCVLHVLRRPAALPLALRRDRPARARRAPAPDGDRRPRASRHRHEKKRICCVAGIRSPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.51
4 0.45
5 0.43
6 0.37
7 0.32
8 0.3
9 0.32
10 0.29
11 0.3
12 0.31
13 0.33
14 0.4
15 0.38
16 0.33
17 0.28
18 0.31
19 0.29
20 0.31
21 0.31
22 0.28
23 0.28
24 0.28
25 0.27
26 0.24
27 0.23
28 0.22
29 0.23
30 0.23
31 0.23
32 0.23
33 0.25
34 0.32
35 0.38
36 0.41
37 0.38
38 0.4
39 0.42
40 0.43
41 0.4
42 0.31
43 0.24
44 0.2
45 0.18
46 0.11
47 0.08
48 0.05
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.06
57 0.06
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.09
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.14
70 0.15
71 0.14
72 0.13
73 0.13
74 0.14
75 0.2
76 0.26
77 0.22
78 0.23
79 0.26
80 0.31
81 0.33
82 0.36
83 0.34
84 0.28
85 0.28
86 0.27
87 0.26
88 0.24
89 0.22
90 0.17
91 0.13
92 0.13
93 0.18
94 0.18
95 0.2
96 0.21
97 0.21
98 0.28
99 0.34
100 0.43
101 0.47
102 0.57
103 0.64
104 0.72
105 0.81
106 0.82
107 0.78
108 0.71
109 0.69
110 0.66
111 0.62
112 0.59
113 0.54
114 0.47
115 0.43
116 0.42
117 0.35
118 0.28
119 0.2
120 0.13
121 0.08
122 0.07
123 0.09
124 0.09
125 0.08
126 0.07
127 0.08
128 0.1
129 0.09
130 0.11
131 0.12
132 0.13
133 0.16
134 0.16
135 0.17
136 0.15
137 0.17
138 0.19
139 0.17
140 0.17
141 0.16
142 0.16
143 0.16
144 0.18
145 0.16
146 0.14
147 0.13
148 0.13
149 0.11
150 0.1
151 0.1
152 0.1
153 0.1
154 0.09
155 0.1
156 0.09
157 0.1
158 0.1
159 0.08
160 0.07
161 0.07
162 0.07
163 0.06
164 0.06
165 0.05
166 0.05
167 0.06
168 0.07
169 0.06
170 0.07
171 0.08
172 0.08
173 0.09
174 0.09
175 0.09
176 0.08
177 0.08
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.09
184 0.09
185 0.11
186 0.12
187 0.14
188 0.18
189 0.2
190 0.21
191 0.23
192 0.26
193 0.25
194 0.24
195 0.23
196 0.22
197 0.19
198 0.23
199 0.24
200 0.22
201 0.26
202 0.26
203 0.25
204 0.21
205 0.21
206 0.16
207 0.12
208 0.16
209 0.12
210 0.13
211 0.14
212 0.13
213 0.12
214 0.12
215 0.12
216 0.06
217 0.07
218 0.09
219 0.09
220 0.09
221 0.09
222 0.09
223 0.09
224 0.09
225 0.08
226 0.05
227 0.05
228 0.05
229 0.05
230 0.06
231 0.07
232 0.07
233 0.07
234 0.13
235 0.14
236 0.18
237 0.23
238 0.24
239 0.25
240 0.25
241 0.29
242 0.28
243 0.31
244 0.31
245 0.33
246 0.36
247 0.42
248 0.48
249 0.48
250 0.43
251 0.4
252 0.37
253 0.32
254 0.29
255 0.23
256 0.21
257 0.24
258 0.33
259 0.35
260 0.36
261 0.39
262 0.42
263 0.47
264 0.53
265 0.56
266 0.56
267 0.63
268 0.7
269 0.73
270 0.76
271 0.73
272 0.71
273 0.7
274 0.69
275 0.7
276 0.7
277 0.69
278 0.66
279 0.68
280 0.69
281 0.72
282 0.73
283 0.74
284 0.77
285 0.81
286 0.87
287 0.92
288 0.94
289 0.93
290 0.93
291 0.9
292 0.81
293 0.76
294 0.71
295 0.7
296 0.67