FuNGI

A0A4S4M0G4

Protein Details

Accession

A0A4S4M0G4

Localization Confidence

Low

Confidence Score

7.1

NoLS Segment(s)

Position	Sequence	Protein Nature
159-184	YDSNDPTTARPKRREKAHKSCMEYMV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 13.5, cyto_nucl 12.333, nucl 9, cyto_mito 8.166

Family & Domain DBs

InterPro	View protein in InterPro IPR000120 Amidase IPR020556 Amidase_CS IPR023631 Amidase_dom IPR036928 AS_sf IPR004412 GatA IPR012340 NA-bd_OB-fold IPR013238 RNA_pol_III_Rbc25 IPR036898 RNA_pol_Rpb7-like_N_sf IPR005576 Rpb7-like_N
Gene Ontology	GO:0000428 C:DNA-directed RNA polymerase complex GO:0030956 C:glutamyl-tRNA(Gln) amidotransferase complex GO:0005739 C:mitochondrion GO:0005634 C:nucleus GO:0004040 F:amidase activity GO:0005524 F:ATP binding GO:0050567 F:glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity GO:0043864 F:indoleacetamide hydrolase activity GO:0006351 P:DNA-templated transcription GO:0070681 P:glutaminyl-tRNAGln biosynthesis via transamidation GO:0032543 P:mitochondrial translation
Pfam	View protein in Pfam PF01425 Amidase PF08292 RNA_pol_Rbc25 PF03876 SHS2_Rpb7-N
PROSITE	View protein in PROSITE PS00571 AMIDASES
CDD	cd04330 RNAP_III_Rpc25_N

Amino Acid Sequences

MPTTCSSAILSEFTSPFDATAVRLLRKAGANIIGKTNCDEFGMGSLNIHSIHGSVINPHQSSLASNVPWEQREKRSAGGSSGGSAAAVAAGMCDSALGTDTGGSIRLPASYCGVVGLKPSYGMISRWGVVSFADSLDCVGIISKDIPSAERVFSTISVYDSNDPTTARPKRREKAHKSCMEYMVDWGDHQKQDLTGLRIGIPQEYFPTSLSFSIQTPFRHVVRSLAARGATLLSVSLPNTSYALSTYYVIASAEASSNLARYDGVQYGLHVDPPPGSPTHTPASTYAHTRTIGFGPEVKKRILLGTYALTADAFDNYFLQSQRLRKLIRQDFNHVFCVPDPLSXSPFLLPRDEGVHVLLHPSAIRTAPXXASPXKSPKDTVXSLDXYMQDVLTVPASLAGLPALNVPICRDQTAGSEGDGWPVGDTIPIHPSRFXVPPEQALINELNKKYANRVLHDVGLCICVFDIAEAGEGKIRYGDGFLWYKVVFRMTVFRPFPSEVILAKVKSSDEEGIQLSVGFFDDIWIPLTYLPQPSTFDPNERAHFWLPGSEATSTHDLLDSPTAERMYIDQGEIVRIRVETDEFYDDEPGPPKATEGVQVKVEARRPPYTITCSIAEQGLGPTAWWKAAEAEAEAMDEG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.19
3	0.17
4	0.16
5	0.15
6	0.12
7	0.19
8	0.22
9	0.21
10	0.23
11	0.24
12	0.28
13	0.3
14	0.31
15	0.28
16	0.31
17	0.35
18	0.35
19	0.42
20	0.39
21	0.37
22	0.38
23	0.35
24	0.28
25	0.24
26	0.22
27	0.15
28	0.16
29	0.19
30	0.16
31	0.15
32	0.15
33	0.15
34	0.15
35	0.15
36	0.12
37	0.08
38	0.09
39	0.11
40	0.1
41	0.12
42	0.18
43	0.24
44	0.24
45	0.24
46	0.25
47	0.23
48	0.24
49	0.25
50	0.25
51	0.18
52	0.19
53	0.23
54	0.27
55	0.29
56	0.33
57	0.35
58	0.37
59	0.43
60	0.45
61	0.44
62	0.45
63	0.44
64	0.41
65	0.39
66	0.33
67	0.28
68	0.26
69	0.22
70	0.16
71	0.14
72	0.11
73	0.06
74	0.05
75	0.04
76	0.03
77	0.03
78	0.03
79	0.03
80	0.03
81	0.03
82	0.03
83	0.04
84	0.04
85	0.04
86	0.05
87	0.05
88	0.06
89	0.07
90	0.06
91	0.06
92	0.07
93	0.09
94	0.1
95	0.1
96	0.13
97	0.13
98	0.13
99	0.14
100	0.14
101	0.13
102	0.14
103	0.14
104	0.11
105	0.11
106	0.11
107	0.11
108	0.12
109	0.12
110	0.14
111	0.15
112	0.15
113	0.16
114	0.16
115	0.15
116	0.13
117	0.14
118	0.11
119	0.09
120	0.09
121	0.07
122	0.08
123	0.07
124	0.07
125	0.05
126	0.05
127	0.05
128	0.06
129	0.07
130	0.07
131	0.08
132	0.09
133	0.1
134	0.12
135	0.15
136	0.14
137	0.14
138	0.14
139	0.14
140	0.15
141	0.16
142	0.13
143	0.12
144	0.13
145	0.14
146	0.16
147	0.16
148	0.17
149	0.16
150	0.16
151	0.16
152	0.24
153	0.31
154	0.36
155	0.45
156	0.53
157	0.6
158	0.71
159	0.8
160	0.81
161	0.84
162	0.87
163	0.85
164	0.82
165	0.8
166	0.74
167	0.65
168	0.55
169	0.45
170	0.38
171	0.3
172	0.23
173	0.2
174	0.2
175	0.17
176	0.17
177	0.16
178	0.14
179	0.18
180	0.22
181	0.22
182	0.2
183	0.2
184	0.2
185	0.21
186	0.21
187	0.18
188	0.15
189	0.12
190	0.12
191	0.13
192	0.13
193	0.12
194	0.13
195	0.12
196	0.12
197	0.13
198	0.12
199	0.11
200	0.13
201	0.16
202	0.16
203	0.19
204	0.23
205	0.22
206	0.24
207	0.23
208	0.23
209	0.25
210	0.28
211	0.24
212	0.23
213	0.22
214	0.2
215	0.2
216	0.17
217	0.12
218	0.08
219	0.07
220	0.05
221	0.06
222	0.06
223	0.06
224	0.06
225	0.07
226	0.07
227	0.07
228	0.07
229	0.07
230	0.08
231	0.08
232	0.08
233	0.08
234	0.08
235	0.08
236	0.08
237	0.07
238	0.06
239	0.06
240	0.05
241	0.05
242	0.06
243	0.05
244	0.06
245	0.06
246	0.06
247	0.05
248	0.06
249	0.08
250	0.08
251	0.1
252	0.1
253	0.1
254	0.14
255	0.14
256	0.14
257	0.12
258	0.11
259	0.1
260	0.11
261	0.13
262	0.09
263	0.11
264	0.11
265	0.14
266	0.17
267	0.16
268	0.17
269	0.17
270	0.21
271	0.2
272	0.22
273	0.21
274	0.2
275	0.21
276	0.2
277	0.2
278	0.16
279	0.16
280	0.14
281	0.16
282	0.16
283	0.21
284	0.23
285	0.21
286	0.21
287	0.2
288	0.21
289	0.18
290	0.15
291	0.12
292	0.1
293	0.11
294	0.1
295	0.1
296	0.08
297	0.08
298	0.07
299	0.06
300	0.05
301	0.04
302	0.04
303	0.05
304	0.07
305	0.07
306	0.08
307	0.11
308	0.14
309	0.18
310	0.23
311	0.24
312	0.25
313	0.35
314	0.42
315	0.46
316	0.46
317	0.5
318	0.51
319	0.52
320	0.52
321	0.42
322	0.34
323	0.27
324	0.28
325	0.21
326	0.15
327	0.14
328	0.14
329	0.16
330	0.15
331	0.16
332	0.13
333	0.14
334	0.15
335	0.13
336	0.12
337	0.13
338	0.13
339	0.13
340	0.12
341	0.11
342	0.1
343	0.11
344	0.09
345	0.07
346	0.06
347	0.06
348	0.06
349	0.06
350	0.06
351	0.06
352	0.09
353	0.14
354	0.17
355	0.21
356	0.23
357	0.28
358	0.33
359	0.34
360	0.33
361	0.31
362	0.31
363	0.28
364	0.31
365	0.28
366	0.23
367	0.22
368	0.2
369	0.17
370	0.14
371	0.12
372	0.07
373	0.05
374	0.05
375	0.04
376	0.05
377	0.05
378	0.04
379	0.04
380	0.04
381	0.04
382	0.04
383	0.04
384	0.04
385	0.05
386	0.05
387	0.07
388	0.11
389	0.11
390	0.12
391	0.12
392	0.12
393	0.14
394	0.17
395	0.16
396	0.12
397	0.13
398	0.13
399	0.13
400	0.13
401	0.1
402	0.08
403	0.07
404	0.07
405	0.06
406	0.07
407	0.07
408	0.12
409	0.14
410	0.14
411	0.15
412	0.17
413	0.21
414	0.24
415	0.23
416	0.22
417	0.22
418	0.25
419	0.25
420	0.24
421	0.21
422	0.2
423	0.23
424	0.24
425	0.23
426	0.23
427	0.24
428	0.24
429	0.25
430	0.29
431	0.3
432	0.27
433	0.33
434	0.32
435	0.35
436	0.35
437	0.32
438	0.26
439	0.24
440	0.2
441	0.14
442	0.11
443	0.07
444	0.06
445	0.06
446	0.05
447	0.04
448	0.05
449	0.05
450	0.06
451	0.08
452	0.08
453	0.08
454	0.08
455	0.09
456	0.07
457	0.08
458	0.09
459	0.12
460	0.14
461	0.14
462	0.16
463	0.16
464	0.17
465	0.17
466	0.18
467	0.13
468	0.12
469	0.18
470	0.19
471	0.28
472	0.28
473	0.28
474	0.31
475	0.32
476	0.32
477	0.29
478	0.28
479	0.19
480	0.23
481	0.25
482	0.21
483	0.2
484	0.21
485	0.18
486	0.16
487	0.19
488	0.16
489	0.13
490	0.16
491	0.16
492	0.15
493	0.15
494	0.14
495	0.11
496	0.09
497	0.09
498	0.06
499	0.05
500	0.05
501	0.06
502	0.07
503	0.09
504	0.09
505	0.09
506	0.1
507	0.12
508	0.14
509	0.16
510	0.16
511	0.16
512	0.19
513	0.21
514	0.28
515	0.28
516	0.3
517	0.33
518	0.38
519	0.4
520	0.39
521	0.41
522	0.35
523	0.36
524	0.31
525	0.28
526	0.24
527	0.22
528	0.22
529	0.18
530	0.17
531	0.19
532	0.21
533	0.19
534	0.18
535	0.16
536	0.14
537	0.15
538	0.18
539	0.16
540	0.14
541	0.16
542	0.16
543	0.15
544	0.16
545	0.16
546	0.18
547	0.18
548	0.17
549	0.16
550	0.16
551	0.2
552	0.21
553	0.2
554	0.16
555	0.14
556	0.15
557	0.15
558	0.16
559	0.14
560	0.17
561	0.19
562	0.19
563	0.2
564	0.22
565	0.21
566	0.22
567	0.24
568	0.22
569	0.21
570	0.19
571	0.19
572	0.19
573	0.19
574	0.24
575	0.25
576	0.27
577	0.27
578	0.3
579	0.32
580	0.35
581	0.39
582	0.38
583	0.39
584	0.41
585	0.41
586	0.44
587	0.48
588	0.49
589	0.48
590	0.46
591	0.43
592	0.41
593	0.4
594	0.34
595	0.28
596	0.21
597	0.18
598	0.16
599	0.14
600	0.12
601	0.12
602	0.13
603	0.14
604	0.13
605	0.13
606	0.12
607	0.15
608	0.17
609	0.16
610	0.17
611	0.16

A0A4S4M0G4

3D AlphaFold-predicted Structure Viewer