Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4M0G4

Protein Details
Accession A0A4S4M0G4   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
159-184YDSNDPTTARPKRREKAHKSCMEYMVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 12.333, nucl 9, cyto_mito 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR000120  Amidase  
IPR020556  Amidase_CS  
IPR023631  Amidase_dom  
IPR036928  AS_sf  
IPR004412  GatA  
IPR012340  NA-bd_OB-fold  
IPR013238  RNA_pol_III_Rbc25  
IPR036898  RNA_pol_Rpb7-like_N_sf  
IPR005576  Rpb7-like_N  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0030956  C:glutamyl-tRNA(Gln) amidotransferase complex  
GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0004040  F:amidase activity  
GO:0005524  F:ATP binding  
GO:0050567  F:glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity  
GO:0043864  F:indoleacetamide hydrolase activity  
GO:0006351  P:DNA-templated transcription  
GO:0070681  P:glutaminyl-tRNAGln biosynthesis via transamidation  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF01425  Amidase  
PF08292  RNA_pol_Rbc25  
PF03876  SHS2_Rpb7-N  
PROSITE View protein in PROSITE  
PS00571  AMIDASES  
CDD cd04330  RNAP_III_Rpc25_N  
Amino Acid Sequences MPTTCSSAILSEFTSPFDATAVRLLRKAGANIIGKTNCDEFGMGSLNIHSIHGSVINPHQSSLASNVPWEQREKRSAGGSSGGSAAAVAAGMCDSALGTDTGGSIRLPASYCGVVGLKPSYGMISRWGVVSFADSLDCVGIISKDIPSAERVFSTISVYDSNDPTTARPKRREKAHKSCMEYMVDWGDHQKQDLTGLRIGIPQEYFPTSLSFSIQTPFRHVVRSLAARGATLLSVSLPNTSYALSTYYVIASAEASSNLARYDGVQYGLHVDPPPGSPTHTPASTYAHTRTIGFGPEVKKRILLGTYALTADAFDNYFLQSQRLRKLIRQDFNHVFCVPDPLSXSPFLLPRDEGVHVLLHPSAIRTAPXXASPXKSPKDTVXSLDXYMQDVLTVPASLAGLPALNVPICRDQTAGSEGDGWPVGDTIPIHPSRFXVPPEQALINELNKKYANRVLHDVGLCICVFDIAEAGEGKIRYGDGFLWYKVVFRMTVFRPFPSEVILAKVKSSDEEGIQLSVGFFDDIWIPLTYLPQPSTFDPNERAHFWLPGSEATSTHDLLDSPTAERMYIDQGEIVRIRVETDEFYDDEPGPPKATEGVQVKVEARRPPYTITCSIAEQGLGPTAWWKAAEAEAEAMDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.16
5 0.15
6 0.12
7 0.19
8 0.22
9 0.21
10 0.23
11 0.24
12 0.28
13 0.3
14 0.31
15 0.28
16 0.31
17 0.35
18 0.35
19 0.42
20 0.39
21 0.37
22 0.38
23 0.35
24 0.28
25 0.24
26 0.22
27 0.15
28 0.16
29 0.19
30 0.16
31 0.15
32 0.15
33 0.15
34 0.15
35 0.15
36 0.12
37 0.08
38 0.09
39 0.11
40 0.1
41 0.12
42 0.18
43 0.24
44 0.24
45 0.24
46 0.25
47 0.23
48 0.24
49 0.25
50 0.25
51 0.18
52 0.19
53 0.23
54 0.27
55 0.29
56 0.33
57 0.35
58 0.37
59 0.43
60 0.45
61 0.44
62 0.45
63 0.44
64 0.41
65 0.39
66 0.33
67 0.28
68 0.26
69 0.22
70 0.16
71 0.14
72 0.11
73 0.06
74 0.05
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.06
89 0.07
90 0.06
91 0.06
92 0.07
93 0.09
94 0.1
95 0.1
96 0.13
97 0.13
98 0.13
99 0.14
100 0.14
101 0.13
102 0.14
103 0.14
104 0.11
105 0.11
106 0.11
107 0.11
108 0.12
109 0.12
110 0.14
111 0.15
112 0.15
113 0.16
114 0.16
115 0.15
116 0.13
117 0.14
118 0.11
119 0.09
120 0.09
121 0.07
122 0.08
123 0.07
124 0.07
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.07
131 0.08
132 0.09
133 0.1
134 0.12
135 0.15
136 0.14
137 0.14
138 0.14
139 0.14
140 0.15
141 0.16
142 0.13
143 0.12
144 0.13
145 0.14
146 0.16
147 0.16
148 0.17
149 0.16
150 0.16
151 0.16
152 0.24
153 0.31
154 0.36
155 0.45
156 0.53
157 0.6
158 0.71
159 0.8
160 0.81
161 0.84
162 0.87
163 0.85
164 0.82
165 0.8
166 0.74
167 0.65
168 0.55
169 0.45
170 0.38
171 0.3
172 0.23
173 0.2
174 0.2
175 0.17
176 0.17
177 0.16
178 0.14
179 0.18
180 0.22
181 0.22
182 0.2
183 0.2
184 0.2
185 0.21
186 0.21
187 0.18
188 0.15
189 0.12
190 0.12
191 0.13
192 0.13
193 0.12
194 0.13
195 0.12
196 0.12
197 0.13
198 0.12
199 0.11
200 0.13
201 0.16
202 0.16
203 0.19
204 0.23
205 0.22
206 0.24
207 0.23
208 0.23
209 0.25
210 0.28
211 0.24
212 0.23
213 0.22
214 0.2
215 0.2
216 0.17
217 0.12
218 0.08
219 0.07
220 0.05
221 0.06
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.07
228 0.07
229 0.07
230 0.08
231 0.08
232 0.08
233 0.08
234 0.08
235 0.08
236 0.08
237 0.07
238 0.06
239 0.06
240 0.05
241 0.05
242 0.06
243 0.05
244 0.06
245 0.06
246 0.06
247 0.05
248 0.06
249 0.08
250 0.08
251 0.1
252 0.1
253 0.1
254 0.14
255 0.14
256 0.14
257 0.12
258 0.11
259 0.1
260 0.11
261 0.13
262 0.09
263 0.11
264 0.11
265 0.14
266 0.17
267 0.16
268 0.17
269 0.17
270 0.21
271 0.2
272 0.22
273 0.21
274 0.2
275 0.21
276 0.2
277 0.2
278 0.16
279 0.16
280 0.14
281 0.16
282 0.16
283 0.21
284 0.23
285 0.21
286 0.21
287 0.2
288 0.21
289 0.18
290 0.15
291 0.12
292 0.1
293 0.11
294 0.1
295 0.1
296 0.08
297 0.08
298 0.07
299 0.06
300 0.05
301 0.04
302 0.04
303 0.05
304 0.07
305 0.07
306 0.08
307 0.11
308 0.14
309 0.18
310 0.23
311 0.24
312 0.25
313 0.35
314 0.42
315 0.46
316 0.46
317 0.5
318 0.51
319 0.52
320 0.52
321 0.42
322 0.34
323 0.27
324 0.28
325 0.21
326 0.15
327 0.14
328 0.14
329 0.16
330 0.15
331 0.16
332 0.13
333 0.14
334 0.15
335 0.13
336 0.12
337 0.13
338 0.13
339 0.13
340 0.12
341 0.11
342 0.1
343 0.11
344 0.09
345 0.07
346 0.06
347 0.06
348 0.06
349 0.06
350 0.06
351 0.06
352 0.09
353 0.14
354 0.17
355 0.21
356 0.23
357 0.28
358 0.33
359 0.34
360 0.33
361 0.31
362 0.31
363 0.28
364 0.31
365 0.28
366 0.23
367 0.22
368 0.2
369 0.17
370 0.14
371 0.12
372 0.07
373 0.05
374 0.05
375 0.04
376 0.05
377 0.05
378 0.04
379 0.04
380 0.04
381 0.04
382 0.04
383 0.04
384 0.04
385 0.05
386 0.05
387 0.07
388 0.11
389 0.11
390 0.12
391 0.12
392 0.12
393 0.14
394 0.17
395 0.16
396 0.12
397 0.13
398 0.13
399 0.13
400 0.13
401 0.1
402 0.08
403 0.07
404 0.07
405 0.06
406 0.07
407 0.07
408 0.12
409 0.14
410 0.14
411 0.15
412 0.17
413 0.21
414 0.24
415 0.23
416 0.22
417 0.22
418 0.25
419 0.25
420 0.24
421 0.21
422 0.2
423 0.23
424 0.24
425 0.23
426 0.23
427 0.24
428 0.24
429 0.25
430 0.29
431 0.3
432 0.27
433 0.33
434 0.32
435 0.35
436 0.35
437 0.32
438 0.26
439 0.24
440 0.2
441 0.14
442 0.11
443 0.07
444 0.06
445 0.06
446 0.05
447 0.04
448 0.05
449 0.05
450 0.06
451 0.08
452 0.08
453 0.08
454 0.08
455 0.09
456 0.07
457 0.08
458 0.09
459 0.12
460 0.14
461 0.14
462 0.16
463 0.16
464 0.17
465 0.17
466 0.18
467 0.13
468 0.12
469 0.18
470 0.19
471 0.28
472 0.28
473 0.28
474 0.31
475 0.32
476 0.32
477 0.29
478 0.28
479 0.19
480 0.23
481 0.25
482 0.21
483 0.2
484 0.21
485 0.18
486 0.16
487 0.19
488 0.16
489 0.13
490 0.16
491 0.16
492 0.15
493 0.15
494 0.14
495 0.11
496 0.09
497 0.09
498 0.06
499 0.05
500 0.05
501 0.06
502 0.07
503 0.09
504 0.09
505 0.09
506 0.1
507 0.12
508 0.14
509 0.16
510 0.16
511 0.16
512 0.19
513 0.21
514 0.28
515 0.28
516 0.3
517 0.33
518 0.38
519 0.4
520 0.39
521 0.41
522 0.35
523 0.36
524 0.31
525 0.28
526 0.24
527 0.22
528 0.22
529 0.18
530 0.17
531 0.19
532 0.21
533 0.19
534 0.18
535 0.16
536 0.14
537 0.15
538 0.18
539 0.16
540 0.14
541 0.16
542 0.16
543 0.15
544 0.16
545 0.16
546 0.18
547 0.18
548 0.17
549 0.16
550 0.16
551 0.2
552 0.21
553 0.2
554 0.16
555 0.14
556 0.15
557 0.15
558 0.16
559 0.14
560 0.17
561 0.19
562 0.19
563 0.2
564 0.22
565 0.21
566 0.22
567 0.24
568 0.22
569 0.21
570 0.19
571 0.19
572 0.19
573 0.19
574 0.24
575 0.25
576 0.27
577 0.27
578 0.3
579 0.32
580 0.35
581 0.39
582 0.38
583 0.39
584 0.41
585 0.41
586 0.44
587 0.48
588 0.49
589 0.48
590 0.46
591 0.43
592 0.41
593 0.4
594 0.34
595 0.28
596 0.21
597 0.18
598 0.16
599 0.14
600 0.12
601 0.12
602 0.13
603 0.14
604 0.13
605 0.13
606 0.12
607 0.15
608 0.17
609 0.16
610 0.17
611 0.16