Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LRY2

Protein Details
Accession A0A4S4LRY2   
Localization Confidence High
Confidence Score 25.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-64AATTVKRTRGRPKGSKNKKSASAHydrophilic
74-95GPSTGEKRKRGRPPKPKPVEEEBasic
97-120ASGEPPVKRKRGRPPKNPKPVESTBasic
127-146IAPEASTKKKRGRPPKTTSTHydrophilic
NLS Segment(s)
PositionSequence
47-62KRTRGRPKGSKNKKSA
78-116GEKRKRGRPPKPKPVEEEGASGEPPVKRKRGRPPKNPKP
134-142KKKRGRPPK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSASPPPDDVADDNNKVLDELDDAVQTGPDDDSGANKADPAAATTVKRTRGRPKGSKNKKSASAAVATTTSAAGPSTGEKRKRGRPPKPKPVEEEGASGEPPVKRKRGRPPKNPKPVESTAENAEEIAPEASTKKKRGRPPKTTST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.21
5 0.15
6 0.1
7 0.1
8 0.11
9 0.1
10 0.11
11 0.1
12 0.1
13 0.09
14 0.09
15 0.07
16 0.06
17 0.07
18 0.06
19 0.08
20 0.09
21 0.11
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.11
30 0.12
31 0.16
32 0.2
33 0.27
34 0.3
35 0.34
36 0.42
37 0.5
38 0.58
39 0.64
40 0.71
41 0.75
42 0.82
43 0.87
44 0.84
45 0.8
46 0.77
47 0.72
48 0.64
49 0.55
50 0.47
51 0.37
52 0.31
53 0.25
54 0.18
55 0.15
56 0.11
57 0.08
58 0.05
59 0.05
60 0.04
61 0.04
62 0.06
63 0.11
64 0.17
65 0.2
66 0.26
67 0.31
68 0.4
69 0.51
70 0.6
71 0.65
72 0.71
73 0.78
74 0.84
75 0.88
76 0.84
77 0.8
78 0.76
79 0.71
80 0.61
81 0.52
82 0.44
83 0.36
84 0.31
85 0.25
86 0.21
87 0.17
88 0.2
89 0.23
90 0.27
91 0.31
92 0.39
93 0.5
94 0.59
95 0.68
96 0.74
97 0.81
98 0.85
99 0.91
100 0.89
101 0.82
102 0.79
103 0.74
104 0.68
105 0.6
106 0.53
107 0.45
108 0.41
109 0.37
110 0.28
111 0.23
112 0.18
113 0.16
114 0.12
115 0.09
116 0.07
117 0.09
118 0.17
119 0.23
120 0.3
121 0.38
122 0.46
123 0.56
124 0.67
125 0.76
126 0.8