Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LST3

Protein Details
Accession A0A4S4LST3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-93HNTPSMSMPRQKKKKKQDDVLKPPDLRKHydrophilic
NLS Segment(s)
PositionSequence
75-81RQKKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTFTMSGSNGSGSRLAADVPPPVPPLPKNIPMSARMKPLPPSPSVPSSLPRRDTSTERRQRRYSGHNTPSMSMPRQKKKKKQDDVLKPPDLRKVPDLLPIFLEMVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.11
5 0.13
6 0.12
7 0.14
8 0.15
9 0.16
10 0.18
11 0.17
12 0.23
13 0.27
14 0.34
15 0.35
16 0.36
17 0.38
18 0.4
19 0.44
20 0.4
21 0.39
22 0.33
23 0.32
24 0.32
25 0.35
26 0.33
27 0.31
28 0.32
29 0.3
30 0.31
31 0.32
32 0.3
33 0.3
34 0.34
35 0.36
36 0.35
37 0.33
38 0.34
39 0.35
40 0.39
41 0.43
42 0.47
43 0.52
44 0.56
45 0.61
46 0.6
47 0.61
48 0.62
49 0.62
50 0.6
51 0.61
52 0.59
53 0.58
54 0.57
55 0.53
56 0.51
57 0.46
58 0.4
59 0.37
60 0.41
61 0.45
62 0.55
63 0.64
64 0.7
65 0.77
66 0.85
67 0.88
68 0.9
69 0.9
70 0.91
71 0.92
72 0.91
73 0.88
74 0.8
75 0.72
76 0.7
77 0.63
78 0.55
79 0.47
80 0.43
81 0.36
82 0.42
83 0.42
84 0.35
85 0.33
86 0.31