Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FJS2

Protein Details
Accession C5FJS2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
183-211GKGKRVSLILTKKRRKRRATPDEAQRLLAHydrophilic
NLS Segment(s)
PositionSequence
192-200LTKKRRKRR
Subcellular Location(s) mito 15.5, mito_nucl 13.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019815  Translation_initiation_fac_3_C  
IPR019814  Translation_initiation_fac_3_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF00707  IF3_C  
PF05198  IF3_N  
Amino Acid Sequences MTCLRPLFSAAQALRCTFIASIESPATQATKQLHGLPTRQLRYYQSTSVLRFSQRPHYPPPAAATAAPSPSRSSPAKDESIPSGIVVVVQENGQLGEPMPLKSALTMFDRSQNYLIQVRAESEGQPAICKIVNKTDYDKSVKERSRASKTKPTTNQIKQIELNWAIDPHDLQHRLSQLETFLGKGKRVSLILTKKRRKRRATPDEAQRLLAAIEDKLFEIGVTEVKPRRGKIMEHMEYVLDKKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.27
4 0.19
5 0.18
6 0.15
7 0.14
8 0.17
9 0.17
10 0.17
11 0.16
12 0.16
13 0.17
14 0.14
15 0.18
16 0.17
17 0.2
18 0.22
19 0.27
20 0.31
21 0.32
22 0.35
23 0.39
24 0.45
25 0.45
26 0.44
27 0.42
28 0.41
29 0.46
30 0.48
31 0.42
32 0.4
33 0.41
34 0.42
35 0.43
36 0.41
37 0.36
38 0.35
39 0.36
40 0.39
41 0.4
42 0.42
43 0.45
44 0.5
45 0.49
46 0.48
47 0.48
48 0.42
49 0.36
50 0.32
51 0.29
52 0.23
53 0.24
54 0.23
55 0.2
56 0.19
57 0.18
58 0.23
59 0.21
60 0.22
61 0.25
62 0.29
63 0.32
64 0.31
65 0.32
66 0.3
67 0.3
68 0.27
69 0.21
70 0.16
71 0.12
72 0.11
73 0.09
74 0.07
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.08
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.11
93 0.13
94 0.12
95 0.19
96 0.2
97 0.21
98 0.22
99 0.2
100 0.2
101 0.2
102 0.19
103 0.13
104 0.13
105 0.13
106 0.13
107 0.13
108 0.11
109 0.09
110 0.1
111 0.09
112 0.09
113 0.08
114 0.08
115 0.08
116 0.08
117 0.09
118 0.15
119 0.17
120 0.18
121 0.23
122 0.25
123 0.28
124 0.31
125 0.32
126 0.3
127 0.37
128 0.39
129 0.38
130 0.42
131 0.45
132 0.52
133 0.56
134 0.58
135 0.59
136 0.6
137 0.66
138 0.66
139 0.65
140 0.65
141 0.64
142 0.67
143 0.6
144 0.59
145 0.51
146 0.46
147 0.45
148 0.36
149 0.32
150 0.23
151 0.21
152 0.18
153 0.17
154 0.16
155 0.11
156 0.17
157 0.16
158 0.16
159 0.19
160 0.2
161 0.21
162 0.22
163 0.21
164 0.14
165 0.16
166 0.16
167 0.13
168 0.17
169 0.18
170 0.19
171 0.19
172 0.2
173 0.19
174 0.2
175 0.21
176 0.24
177 0.34
178 0.43
179 0.53
180 0.61
181 0.67
182 0.78
183 0.85
184 0.86
185 0.86
186 0.88
187 0.88
188 0.89
189 0.89
190 0.89
191 0.89
192 0.81
193 0.71
194 0.59
195 0.48
196 0.38
197 0.3
198 0.2
199 0.11
200 0.1
201 0.1
202 0.1
203 0.1
204 0.1
205 0.07
206 0.07
207 0.08
208 0.09
209 0.1
210 0.16
211 0.2
212 0.27
213 0.32
214 0.32
215 0.4
216 0.41
217 0.43
218 0.47
219 0.55
220 0.52
221 0.51
222 0.51
223 0.44
224 0.42
225 0.43