Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FHK9

Protein Details
Accession C5FHK9   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-170RTVISNEKKRREKEKLAEEQKREEBasic
NLS Segment(s)
PositionSequence
154-163KKRREKEKLA
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAESRPVHHALYPETSFMAEDPTATPRGGVRLNKIAESWEDEDLSSEEEEEEQDSDAETTITAPRSYSPALSVDSQAPPLQHGIRAPPPTPNISRQSSCRSTTSNASHASSTYSKRPEKQAAVANRMIASALGVRAPRSEAQKAYDRTVISNEKKRREKEKLAEEQKREEAEKAKAAIWDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.19
5 0.19
6 0.12
7 0.11
8 0.12
9 0.15
10 0.16
11 0.15
12 0.16
13 0.13
14 0.17
15 0.22
16 0.24
17 0.26
18 0.33
19 0.34
20 0.35
21 0.34
22 0.31
23 0.27
24 0.3
25 0.26
26 0.2
27 0.19
28 0.18
29 0.19
30 0.18
31 0.18
32 0.12
33 0.1
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.06
47 0.07
48 0.09
49 0.08
50 0.08
51 0.09
52 0.12
53 0.13
54 0.12
55 0.11
56 0.12
57 0.13
58 0.14
59 0.15
60 0.14
61 0.14
62 0.15
63 0.14
64 0.13
65 0.11
66 0.13
67 0.12
68 0.1
69 0.1
70 0.13
71 0.17
72 0.2
73 0.19
74 0.21
75 0.22
76 0.25
77 0.26
78 0.28
79 0.28
80 0.29
81 0.3
82 0.3
83 0.36
84 0.36
85 0.36
86 0.33
87 0.31
88 0.3
89 0.35
90 0.35
91 0.32
92 0.3
93 0.29
94 0.28
95 0.25
96 0.27
97 0.23
98 0.22
99 0.23
100 0.28
101 0.3
102 0.33
103 0.4
104 0.43
105 0.43
106 0.46
107 0.48
108 0.47
109 0.5
110 0.47
111 0.42
112 0.35
113 0.32
114 0.26
115 0.18
116 0.12
117 0.08
118 0.07
119 0.08
120 0.08
121 0.08
122 0.09
123 0.12
124 0.14
125 0.18
126 0.22
127 0.22
128 0.27
129 0.35
130 0.38
131 0.39
132 0.4
133 0.35
134 0.33
135 0.37
136 0.42
137 0.41
138 0.48
139 0.52
140 0.58
141 0.66
142 0.72
143 0.75
144 0.76
145 0.79
146 0.79
147 0.82
148 0.83
149 0.85
150 0.87
151 0.82
152 0.79
153 0.74
154 0.68
155 0.59
156 0.53
157 0.48
158 0.44
159 0.46
160 0.41
161 0.37