Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V6DHE8

Protein Details
Accession A0A4V6DHE8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
25-54PPSDRPKTPNTPKTPKTPKTPKTPANPNVTHydrophilic
NLS Segment(s)
PositionSequence
155-165RRREAARRKRE
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013960  DASH_Duo1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF08651  DASH_Duo1  
Amino Acid Sequences MADYTDDSLTEDVWASPRPEGEIAPPSDRPKTPNTPKTPKTPKTPKTPANPNVTFDREAALRKELEGVRNINAAIEGIIATLDKAKGNMNTVGGTVSNASTLLNTWTRILSQTEHNQRLILNPNWRGASNDLVEIEAEAVQKQQIAERRVAEEERRREAARRKREEDEEERQRQAAVGNAPRGRVVSRGRARGTAGTTRGHGYTSSTSRIGRGAASIRGGFRGRARGTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.16
5 0.18
6 0.18
7 0.19
8 0.21
9 0.26
10 0.28
11 0.3
12 0.34
13 0.35
14 0.39
15 0.4
16 0.39
17 0.39
18 0.46
19 0.53
20 0.59
21 0.65
22 0.7
23 0.73
24 0.8
25 0.83
26 0.79
27 0.79
28 0.8
29 0.78
30 0.78
31 0.84
32 0.81
33 0.79
34 0.83
35 0.8
36 0.79
37 0.74
38 0.66
39 0.62
40 0.58
41 0.5
42 0.39
43 0.34
44 0.26
45 0.26
46 0.25
47 0.22
48 0.18
49 0.16
50 0.22
51 0.22
52 0.23
53 0.24
54 0.24
55 0.23
56 0.23
57 0.23
58 0.17
59 0.15
60 0.12
61 0.08
62 0.06
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.04
69 0.05
70 0.05
71 0.06
72 0.08
73 0.09
74 0.12
75 0.13
76 0.13
77 0.13
78 0.13
79 0.12
80 0.1
81 0.1
82 0.08
83 0.06
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.09
95 0.1
96 0.11
97 0.1
98 0.14
99 0.21
100 0.29
101 0.31
102 0.31
103 0.3
104 0.28
105 0.3
106 0.31
107 0.27
108 0.25
109 0.25
110 0.27
111 0.28
112 0.28
113 0.27
114 0.22
115 0.22
116 0.17
117 0.16
118 0.13
119 0.13
120 0.12
121 0.1
122 0.09
123 0.07
124 0.06
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.09
131 0.14
132 0.16
133 0.19
134 0.2
135 0.23
136 0.24
137 0.26
138 0.3
139 0.32
140 0.36
141 0.38
142 0.4
143 0.39
144 0.43
145 0.51
146 0.54
147 0.56
148 0.6
149 0.61
150 0.63
151 0.68
152 0.7
153 0.68
154 0.68
155 0.67
156 0.63
157 0.59
158 0.53
159 0.47
160 0.4
161 0.33
162 0.27
163 0.24
164 0.24
165 0.3
166 0.31
167 0.31
168 0.31
169 0.31
170 0.27
171 0.27
172 0.27
173 0.3
174 0.36
175 0.43
176 0.45
177 0.46
178 0.47
179 0.45
180 0.46
181 0.42
182 0.37
183 0.32
184 0.32
185 0.32
186 0.3
187 0.26
188 0.22
189 0.19
190 0.23
191 0.25
192 0.27
193 0.28
194 0.28
195 0.28
196 0.3
197 0.26
198 0.2
199 0.2
200 0.2
201 0.21
202 0.24
203 0.25
204 0.24
205 0.28
206 0.28
207 0.27
208 0.28
209 0.34