Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XNN0

Protein Details
Accession A0A4U6XNN0   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-116TGSYRTCQGNKRNKEKKKKTLNADPYAVHydrophilic
NLS Segment(s)
PositionSequence
99-107KRNKEKKKK
Subcellular Location(s) mito 14, cyto 5, nucl 4, extr 4
Family & Domain DBs
Amino Acid Sequences MHPSIVAEASRLLSFVAVTPKAVPSLPFSPTLPRSDPIYTQANACPTSHPAAASVHTVAVQSRRAHVSARTPSHSTLEGSTSLPLCWITGSYRTCQGNKRNKEKKKKTLNADPYAVVEPQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.15
4 0.13
5 0.14
6 0.15
7 0.16
8 0.17
9 0.17
10 0.16
11 0.16
12 0.18
13 0.19
14 0.21
15 0.21
16 0.26
17 0.28
18 0.32
19 0.29
20 0.27
21 0.3
22 0.3
23 0.3
24 0.28
25 0.3
26 0.25
27 0.25
28 0.25
29 0.24
30 0.23
31 0.22
32 0.19
33 0.17
34 0.19
35 0.18
36 0.16
37 0.14
38 0.13
39 0.14
40 0.14
41 0.12
42 0.09
43 0.09
44 0.09
45 0.08
46 0.09
47 0.12
48 0.11
49 0.13
50 0.14
51 0.14
52 0.15
53 0.17
54 0.23
55 0.26
56 0.3
57 0.32
58 0.32
59 0.33
60 0.34
61 0.33
62 0.26
63 0.19
64 0.18
65 0.15
66 0.14
67 0.14
68 0.13
69 0.11
70 0.11
71 0.1
72 0.08
73 0.07
74 0.07
75 0.08
76 0.14
77 0.16
78 0.18
79 0.24
80 0.28
81 0.31
82 0.38
83 0.46
84 0.5
85 0.58
86 0.68
87 0.72
88 0.79
89 0.87
90 0.9
91 0.91
92 0.92
93 0.91
94 0.9
95 0.91
96 0.91
97 0.87
98 0.79
99 0.7
100 0.62
101 0.55