Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V6DFA9

Protein Details
Accession A0A4V6DFA9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-153GYLGRERKRGRERGNKERKIQKPRRARPAVSARLBasic
NLS Segment(s)
PositionSequence
113-148KMRRDRGGYLGRERKRGRERGNKERKIQKPRRARPA
Subcellular Location(s) mito 15, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MAVPIIYTIKHCTAPQVARNSGHPWRGPLTESERARERGTLANVVVRKGGNLLSISQNLPQLAASFATLSKQQHRQANGFLFPNGAKPPISSRMYPDPPPPDWTPSSEWQRLKMRRDRGGYLGRERKRGRERGNKERKIQKPRRARPAVSARLVERSPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.45
4 0.46
5 0.45
6 0.49
7 0.5
8 0.48
9 0.47
10 0.42
11 0.37
12 0.37
13 0.36
14 0.35
15 0.34
16 0.35
17 0.38
18 0.38
19 0.39
20 0.41
21 0.42
22 0.42
23 0.38
24 0.33
25 0.3
26 0.32
27 0.3
28 0.25
29 0.27
30 0.27
31 0.26
32 0.25
33 0.18
34 0.16
35 0.14
36 0.14
37 0.1
38 0.1
39 0.12
40 0.13
41 0.14
42 0.15
43 0.15
44 0.16
45 0.14
46 0.13
47 0.12
48 0.1
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.07
55 0.09
56 0.1
57 0.14
58 0.2
59 0.25
60 0.29
61 0.32
62 0.33
63 0.35
64 0.36
65 0.34
66 0.28
67 0.23
68 0.2
69 0.17
70 0.17
71 0.13
72 0.12
73 0.09
74 0.09
75 0.12
76 0.18
77 0.2
78 0.19
79 0.23
80 0.3
81 0.34
82 0.35
83 0.38
84 0.36
85 0.35
86 0.4
87 0.37
88 0.34
89 0.31
90 0.33
91 0.32
92 0.34
93 0.4
94 0.42
95 0.41
96 0.43
97 0.52
98 0.54
99 0.58
100 0.59
101 0.61
102 0.61
103 0.65
104 0.62
105 0.59
106 0.61
107 0.58
108 0.6
109 0.61
110 0.57
111 0.62
112 0.6
113 0.63
114 0.64
115 0.69
116 0.69
117 0.7
118 0.76
119 0.78
120 0.88
121 0.86
122 0.86
123 0.86
124 0.86
125 0.86
126 0.87
127 0.86
128 0.86
129 0.87
130 0.89
131 0.88
132 0.81
133 0.8
134 0.81
135 0.8
136 0.74
137 0.69
138 0.59
139 0.57
140 0.54