Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6X850

Protein Details
Accession A0A4U6X850    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-51QYRQRHIKPSEGKRIAKRKRRASAAVSHydrophilic
NLS Segment(s)
PositionSequence
29-47RHIKPSEGKRIAKRKRRAS
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MARDVSFVTNKLADKERSLLSPLGQYRQRHIKPSEGKRIAKRKRRASAAVSTKLVKSERPPAPELASFIDVGLVAIARNLEKLAAGQQEGTSKDDNTTANSSSPYSVIFVARSGQPSAFNCQLPQMVAVASKSSPCEPQTRLVGYSRPCAENLSACLGIPRASAVGIRVGAPMSKALVDYVQQHVSPVRVAWLEEAEKAVYRSTQLKIDEKMVPAKKSGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.34
4 0.31
5 0.34
6 0.31
7 0.26
8 0.31
9 0.31
10 0.34
11 0.38
12 0.37
13 0.41
14 0.51
15 0.52
16 0.53
17 0.53
18 0.56
19 0.6
20 0.68
21 0.72
22 0.7
23 0.73
24 0.75
25 0.83
26 0.83
27 0.83
28 0.83
29 0.82
30 0.83
31 0.84
32 0.8
33 0.76
34 0.76
35 0.75
36 0.7
37 0.63
38 0.55
39 0.48
40 0.45
41 0.4
42 0.32
43 0.27
44 0.31
45 0.34
46 0.37
47 0.39
48 0.37
49 0.4
50 0.38
51 0.36
52 0.29
53 0.25
54 0.2
55 0.17
56 0.15
57 0.11
58 0.1
59 0.08
60 0.05
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.08
71 0.08
72 0.09
73 0.09
74 0.1
75 0.13
76 0.14
77 0.16
78 0.13
79 0.12
80 0.13
81 0.15
82 0.14
83 0.15
84 0.16
85 0.14
86 0.14
87 0.15
88 0.14
89 0.13
90 0.12
91 0.1
92 0.08
93 0.08
94 0.08
95 0.07
96 0.07
97 0.08
98 0.09
99 0.1
100 0.09
101 0.09
102 0.11
103 0.12
104 0.17
105 0.18
106 0.17
107 0.16
108 0.17
109 0.17
110 0.14
111 0.14
112 0.09
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.09
121 0.11
122 0.13
123 0.17
124 0.18
125 0.22
126 0.26
127 0.27
128 0.28
129 0.27
130 0.3
131 0.27
132 0.31
133 0.29
134 0.26
135 0.24
136 0.24
137 0.24
138 0.21
139 0.21
140 0.2
141 0.17
142 0.16
143 0.16
144 0.15
145 0.14
146 0.12
147 0.1
148 0.06
149 0.06
150 0.07
151 0.07
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.1
159 0.09
160 0.08
161 0.08
162 0.07
163 0.07
164 0.08
165 0.09
166 0.12
167 0.16
168 0.17
169 0.17
170 0.18
171 0.18
172 0.19
173 0.18
174 0.15
175 0.14
176 0.12
177 0.13
178 0.14
179 0.17
180 0.17
181 0.17
182 0.18
183 0.16
184 0.16
185 0.17
186 0.16
187 0.13
188 0.15
189 0.18
190 0.19
191 0.25
192 0.28
193 0.33
194 0.35
195 0.39
196 0.41
197 0.4
198 0.47
199 0.47
200 0.44
201 0.44