Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U6XH29

Protein Details
Accession A0A4U6XH29    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-60HDAIRQQKKKHWHKFLAEDTNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MLTLVIHTFWRNRARAGRRAGYRPPDMEERAQAAAKQYHDAIRQQKKKHWHKFLAEDTNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.58
4 0.6
5 0.58
6 0.62
7 0.63
8 0.6
9 0.57
10 0.5
11 0.46
12 0.43
13 0.4
14 0.35
15 0.3
16 0.26
17 0.23
18 0.22
19 0.18
20 0.16
21 0.17
22 0.16
23 0.16
24 0.15
25 0.17
26 0.19
27 0.25
28 0.32
29 0.4
30 0.47
31 0.51
32 0.56
33 0.64
34 0.73
35 0.78
36 0.78
37 0.77
38 0.78
39 0.82
40 0.86