Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V6DFZ7

Protein Details
Accession A0A4V6DFZ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-40TSAEAEKCKKYKRCWCRRDQVETNGTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, golg 2, mito 1, cyto 1, E.R. 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MKLSSVFLIVALALTSAEAEKCKKYKRCWCRRDQVETNGTTLHHVAWDAFTAKACEDNGGEGRVDTFDDNTHKECYRYKKGAFWRNGGINLCEWRKRCVYAGKMDNNPLVDGVCRNAIASWKVSQSHPSSRTTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.06
5 0.08
6 0.1
7 0.16
8 0.22
9 0.32
10 0.39
11 0.49
12 0.59
13 0.68
14 0.77
15 0.81
16 0.85
17 0.87
18 0.88
19 0.88
20 0.85
21 0.83
22 0.78
23 0.69
24 0.6
25 0.5
26 0.42
27 0.33
28 0.25
29 0.16
30 0.1
31 0.09
32 0.08
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.1
41 0.09
42 0.09
43 0.08
44 0.1
45 0.1
46 0.11
47 0.1
48 0.08
49 0.09
50 0.08
51 0.08
52 0.06
53 0.06
54 0.06
55 0.08
56 0.1
57 0.12
58 0.14
59 0.14
60 0.16
61 0.21
62 0.27
63 0.34
64 0.38
65 0.38
66 0.43
67 0.52
68 0.59
69 0.59
70 0.54
71 0.51
72 0.47
73 0.5
74 0.44
75 0.35
76 0.28
77 0.29
78 0.29
79 0.28
80 0.27
81 0.27
82 0.29
83 0.3
84 0.32
85 0.35
86 0.38
87 0.43
88 0.5
89 0.53
90 0.54
91 0.56
92 0.54
93 0.46
94 0.41
95 0.32
96 0.23
97 0.17
98 0.14
99 0.13
100 0.12
101 0.11
102 0.11
103 0.12
104 0.15
105 0.16
106 0.18
107 0.19
108 0.22
109 0.24
110 0.25
111 0.31
112 0.34
113 0.41
114 0.42