Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V6DGW2

Protein Details
Accession A0A4V6DGW2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
97-124RYERQAKHYRCRTARSRKKQTKEPIFIAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024096  NO_sig/Golgi_transp_ligand-bd  
IPR007194  TRAPP_component  
IPR037992  TRAPPC6/Trs33  
Gene Ontology GO:0048193  P:Golgi vesicle transport  
GO:0043087  P:regulation of GTPase activity  
Pfam View protein in Pfam  
PF04051  TRAPP  
CDD cd14944  TRAPPC6A_Trs33  
Amino Acid Sequences MPSSTKYVPNPLVCRPDSSFTYAFVSTYLALVHQAADKHDDTSCHCILPNIPSQRFSQAAHNPNSTAIHLCEVLSRPCHIVIGYRAISQTYLYLSQRYERQAKHYRCRTARSRKKQTKEPIFIAAMSFESVMPPYNATDPSASFLNSSCLDFLLIELVPLAFRVTRELDTAPIGDTANGTVAGAPSSTGGGASADTLSSVSHSQGGGAAGGSAGGLAPSSADGAAGGSTARKMDEDEERDAVFYRLETLGYRVGQGLVERFSRDRPRFNDTLDVIKFVCKDLWSLVFRKQVDNLKTNHRGVYVLTDNSFKPFSRMSTEAGGQAVVRAQPFLWFPCGIVRGALAALGINATVQAETNELPAAIFQIKTLPSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.5
4 0.46
5 0.48
6 0.41
7 0.35
8 0.38
9 0.32
10 0.28
11 0.23
12 0.21
13 0.15
14 0.14
15 0.12
16 0.08
17 0.09
18 0.09
19 0.1
20 0.11
21 0.12
22 0.13
23 0.18
24 0.18
25 0.19
26 0.21
27 0.21
28 0.23
29 0.29
30 0.28
31 0.24
32 0.24
33 0.24
34 0.25
35 0.29
36 0.33
37 0.35
38 0.36
39 0.37
40 0.39
41 0.42
42 0.42
43 0.38
44 0.39
45 0.38
46 0.45
47 0.48
48 0.48
49 0.44
50 0.43
51 0.43
52 0.35
53 0.28
54 0.21
55 0.18
56 0.16
57 0.16
58 0.17
59 0.18
60 0.2
61 0.19
62 0.2
63 0.19
64 0.19
65 0.2
66 0.16
67 0.18
68 0.18
69 0.24
70 0.23
71 0.23
72 0.23
73 0.22
74 0.23
75 0.19
76 0.17
77 0.11
78 0.14
79 0.13
80 0.15
81 0.16
82 0.19
83 0.24
84 0.28
85 0.34
86 0.31
87 0.4
88 0.48
89 0.56
90 0.63
91 0.67
92 0.71
93 0.69
94 0.75
95 0.77
96 0.78
97 0.8
98 0.81
99 0.84
100 0.84
101 0.87
102 0.88
103 0.89
104 0.88
105 0.84
106 0.76
107 0.7
108 0.61
109 0.53
110 0.44
111 0.33
112 0.23
113 0.16
114 0.13
115 0.07
116 0.06
117 0.06
118 0.07
119 0.06
120 0.07
121 0.07
122 0.09
123 0.1
124 0.1
125 0.11
126 0.11
127 0.12
128 0.12
129 0.12
130 0.1
131 0.1
132 0.12
133 0.12
134 0.12
135 0.1
136 0.09
137 0.09
138 0.09
139 0.08
140 0.07
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.06
151 0.08
152 0.09
153 0.11
154 0.11
155 0.12
156 0.12
157 0.13
158 0.11
159 0.1
160 0.09
161 0.07
162 0.07
163 0.06
164 0.06
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.04
180 0.03
181 0.03
182 0.03
183 0.04
184 0.03
185 0.04
186 0.05
187 0.05
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.06
194 0.06
195 0.05
196 0.04
197 0.04
198 0.04
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.04
217 0.04
218 0.05
219 0.06
220 0.08
221 0.15
222 0.19
223 0.22
224 0.23
225 0.23
226 0.23
227 0.23
228 0.21
229 0.14
230 0.1
231 0.1
232 0.08
233 0.09
234 0.09
235 0.1
236 0.13
237 0.13
238 0.14
239 0.12
240 0.12
241 0.12
242 0.12
243 0.12
244 0.11
245 0.12
246 0.13
247 0.13
248 0.19
249 0.29
250 0.32
251 0.38
252 0.4
253 0.47
254 0.47
255 0.48
256 0.5
257 0.42
258 0.46
259 0.39
260 0.37
261 0.3
262 0.29
263 0.28
264 0.21
265 0.21
266 0.13
267 0.13
268 0.14
269 0.2
270 0.21
271 0.23
272 0.28
273 0.34
274 0.35
275 0.35
276 0.39
277 0.41
278 0.44
279 0.47
280 0.45
281 0.47
282 0.54
283 0.54
284 0.5
285 0.42
286 0.37
287 0.32
288 0.35
289 0.3
290 0.25
291 0.24
292 0.25
293 0.25
294 0.27
295 0.28
296 0.21
297 0.19
298 0.19
299 0.21
300 0.25
301 0.27
302 0.27
303 0.3
304 0.31
305 0.29
306 0.28
307 0.25
308 0.18
309 0.17
310 0.15
311 0.12
312 0.11
313 0.1
314 0.1
315 0.12
316 0.14
317 0.16
318 0.18
319 0.17
320 0.17
321 0.22
322 0.24
323 0.21
324 0.19
325 0.17
326 0.14
327 0.14
328 0.14
329 0.08
330 0.06
331 0.06
332 0.06
333 0.05
334 0.04
335 0.04
336 0.04
337 0.05
338 0.05
339 0.05
340 0.07
341 0.08
342 0.09
343 0.1
344 0.09
345 0.09
346 0.09
347 0.12
348 0.12
349 0.11
350 0.1
351 0.15
352 0.16