Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V6DHS7

Protein Details
Accession A0A4V6DHS7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-109SRTDREQKSGWPKTNRPPLFHydrophilic
NLS Segment(s)
PositionSequence
35-38RKWG
41-46ARGKGR
Subcellular Location(s) extr 12, mito 7.5, cyto_mito 6, cyto 3.5, nucl 2, pero 2
Family & Domain DBs
Amino Acid Sequences MGVLCTQSCLRPVGAGAGALQAHNTPKIDREAKERKWGNYARGKGRRAAHVLATFPQAWVSLTDDDDDDDDNDDDDNDDDDERSRVGAWSRTDREQKSGWPKTNRPPLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.13
5 0.13
6 0.12
7 0.12
8 0.09
9 0.1
10 0.12
11 0.13
12 0.11
13 0.14
14 0.21
15 0.25
16 0.26
17 0.34
18 0.42
19 0.45
20 0.54
21 0.56
22 0.51
23 0.55
24 0.57
25 0.55
26 0.54
27 0.56
28 0.56
29 0.6
30 0.59
31 0.56
32 0.56
33 0.53
34 0.48
35 0.43
36 0.37
37 0.31
38 0.3
39 0.25
40 0.25
41 0.2
42 0.16
43 0.14
44 0.1
45 0.09
46 0.08
47 0.1
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.07
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.08
68 0.09
69 0.08
70 0.08
71 0.08
72 0.09
73 0.12
74 0.18
75 0.22
76 0.3
77 0.34
78 0.42
79 0.49
80 0.5
81 0.52
82 0.49
83 0.53
84 0.55
85 0.6
86 0.62
87 0.63
88 0.68
89 0.74