Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U6XF53

Protein Details
Accession A0A4U6XF53    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-86KKDKHGWMSNKKKDRHPHRKHKKCKKPYDDSCTSDSBasic
NLS Segment(s)
PositionSequence
44-76ARRDPLAKKDKHGWMSNKKKDRHPHRKHKKCKK
Subcellular Location(s) extr 9, mito 5, plas 3, golg 3, nucl 2, cyto 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRLLLSTVFFITLLLLGTLVRSAAVDRKAVAELSKRSDVSGPIARRDPLAKKDKHGWMSNKKKDRHPHRKHKKCKKPYDDSCTSDSDFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.05
10 0.09
11 0.11
12 0.12
13 0.12
14 0.14
15 0.15
16 0.15
17 0.16
18 0.16
19 0.17
20 0.22
21 0.24
22 0.23
23 0.23
24 0.24
25 0.23
26 0.22
27 0.27
28 0.23
29 0.22
30 0.24
31 0.23
32 0.23
33 0.25
34 0.24
35 0.26
36 0.34
37 0.33
38 0.35
39 0.43
40 0.49
41 0.51
42 0.54
43 0.55
44 0.57
45 0.66
46 0.72
47 0.73
48 0.71
49 0.74
50 0.78
51 0.8
52 0.81
53 0.81
54 0.83
55 0.86
56 0.92
57 0.95
58 0.96
59 0.96
60 0.95
61 0.96
62 0.95
63 0.94
64 0.94
65 0.92
66 0.9
67 0.83
68 0.76
69 0.69