Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q756G6

Protein Details
Accession Q756G6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
120-140MVALKQKMKNQRRSQLHERIVHydrophilic
NLS Segment(s)
PositionSequence
183-187KKRKR
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022592  Nucleolar_19  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0032040  C:small-subunit processome  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ago:AGOS_AER300C  -  
Pfam View protein in Pfam  
PF10863  NOP19  
Amino Acid Sequences MSNSKDIKDRQRLQATLQAAFSEKAARVEEWLGSASDSGPSTDLSESRQAFLKLPVVQIGGGLRFDTQAATQDTNSIHTLGDFVTGNKSLSTLAKKKQAAQPSSKQNSIYRVDKEDTKAMVALKQKMKNQRRSQLHERIVETAPSETPAQERGTADDDDSDDSDEAPVEKMTKKKVGLLFLDKKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.5
4 0.43
5 0.34
6 0.27
7 0.25
8 0.22
9 0.18
10 0.16
11 0.16
12 0.18
13 0.17
14 0.17
15 0.19
16 0.18
17 0.16
18 0.16
19 0.13
20 0.12
21 0.12
22 0.09
23 0.1
24 0.1
25 0.09
26 0.09
27 0.09
28 0.1
29 0.11
30 0.11
31 0.12
32 0.19
33 0.19
34 0.19
35 0.22
36 0.22
37 0.22
38 0.24
39 0.26
40 0.21
41 0.2
42 0.21
43 0.18
44 0.17
45 0.16
46 0.15
47 0.1
48 0.09
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.09
56 0.11
57 0.12
58 0.12
59 0.14
60 0.15
61 0.16
62 0.17
63 0.13
64 0.11
65 0.09
66 0.1
67 0.07
68 0.09
69 0.07
70 0.06
71 0.07
72 0.08
73 0.09
74 0.08
75 0.08
76 0.07
77 0.1
78 0.15
79 0.17
80 0.21
81 0.28
82 0.29
83 0.33
84 0.38
85 0.43
86 0.42
87 0.44
88 0.48
89 0.52
90 0.55
91 0.52
92 0.49
93 0.43
94 0.44
95 0.43
96 0.4
97 0.32
98 0.32
99 0.32
100 0.33
101 0.34
102 0.31
103 0.27
104 0.23
105 0.22
106 0.18
107 0.21
108 0.22
109 0.26
110 0.29
111 0.34
112 0.39
113 0.48
114 0.57
115 0.63
116 0.68
117 0.71
118 0.73
119 0.77
120 0.81
121 0.81
122 0.79
123 0.74
124 0.66
125 0.6
126 0.53
127 0.45
128 0.36
129 0.27
130 0.2
131 0.17
132 0.16
133 0.12
134 0.12
135 0.14
136 0.15
137 0.16
138 0.17
139 0.18
140 0.21
141 0.21
142 0.2
143 0.18
144 0.18
145 0.17
146 0.17
147 0.16
148 0.13
149 0.12
150 0.12
151 0.11
152 0.11
153 0.1
154 0.1
155 0.11
156 0.15
157 0.2
158 0.26
159 0.32
160 0.33
161 0.39
162 0.43
163 0.47
164 0.5
165 0.56
166 0.6
167 0.63