Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XHD3

Protein Details
Accession A0A4U6XHD3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-27HPPAAATRPKPRGHKKAVQGSATHydrophilic
NLS Segment(s)
PositionSequence
12-20RPKPRGHKK
58-80KPKQPKTAAARAATGEKRLRRFR
Subcellular Location(s) mito 15, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007527  Znf_SWIM  
IPR039903  Zswim2  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MGGFHPPAAATRPKPRGHKKAVQGSATRASQMMPMAPPSRKRKAISSDDEQQSESPAKPKQPKTAAARAATGEKRLRRFRPNPPQSFHDVYHRATTQRFYVLERWRCGTDDVPEEEVELTGSTDNVYTVHIGQVPSCSCPHSLKGNQCKHWLFVGFPRQPLNPGRRFRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.75
4 0.77
5 0.8
6 0.8
7 0.83
8 0.83
9 0.79
10 0.71
11 0.66
12 0.63
13 0.55
14 0.46
15 0.35
16 0.28
17 0.24
18 0.21
19 0.18
20 0.12
21 0.16
22 0.2
23 0.23
24 0.31
25 0.37
26 0.44
27 0.48
28 0.5
29 0.53
30 0.58
31 0.63
32 0.62
33 0.61
34 0.62
35 0.59
36 0.58
37 0.51
38 0.42
39 0.36
40 0.31
41 0.25
42 0.2
43 0.19
44 0.26
45 0.34
46 0.38
47 0.45
48 0.48
49 0.54
50 0.57
51 0.63
52 0.61
53 0.54
54 0.5
55 0.42
56 0.43
57 0.35
58 0.33
59 0.29
60 0.28
61 0.33
62 0.39
63 0.43
64 0.47
65 0.52
66 0.59
67 0.65
68 0.71
69 0.7
70 0.67
71 0.66
72 0.63
73 0.6
74 0.51
75 0.46
76 0.39
77 0.34
78 0.34
79 0.31
80 0.26
81 0.23
82 0.24
83 0.18
84 0.18
85 0.18
86 0.17
87 0.23
88 0.31
89 0.36
90 0.36
91 0.37
92 0.35
93 0.36
94 0.35
95 0.29
96 0.24
97 0.23
98 0.24
99 0.23
100 0.22
101 0.21
102 0.2
103 0.17
104 0.14
105 0.09
106 0.07
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.08
117 0.1
118 0.1
119 0.11
120 0.14
121 0.15
122 0.16
123 0.16
124 0.17
125 0.17
126 0.2
127 0.23
128 0.28
129 0.35
130 0.43
131 0.52
132 0.6
133 0.63
134 0.68
135 0.67
136 0.6
137 0.58
138 0.5
139 0.42
140 0.41
141 0.47
142 0.42
143 0.43
144 0.45
145 0.4
146 0.43
147 0.49
148 0.49
149 0.48